Import-Export Bulletin Board Post an Offer to Sell

New here? Please subscribe
to post trade leads. It's FREE!

Other Chemicals


Home > Offers to Sell > Chemicals & Plastics > Other Chemicals

Browse leads by category:
    
    
 
 

Summary of 3/29/26 8:39 GMT:>> Show Compact View
3/22/22 3:15 GMT
SNF NSF PNS FDN Polynaphthalene Sulfonate Superplasticizer 18% Na2SO4

SNF NSF PNS FDN High Range Water Reducer Sodium Naphthalene Sulfonate Na2SO4 Content 18% Concrete Admixture Product Description: Naphthalene series superplasticizer (naphthalenesulfonic acid formaldehyde condensate) and some other chemical admixtures play an important role in modern concrete materials and technologies. It can improve the various properties of concrete and promote the development of new concrete technologies. When used together with mineral admixtures (also known as mineral admixtures), it promotes the utilization of industrial by-products (such as ground slag and fly ash) in the cementitious material system, which helps to save resources and protect the environment. With the continuous search for more low-cost, environmentally compatible materials and technologies, it can be expected that naphthalene-based superplasticizers will play an important role in future concrete production. ITEMS SPECIFICATIONS Appearance Free flowing brown powder Solid content ≥93% Bulk density ca (gm/cc) 0.60 – 0.75 pH (10% aq. Solution) at 25℃ 7.0 – 9.0 Na2SO4 content ≤18% Clarity in 10% aq. Solution Clear solution Water insoluble matter 0.5% Max.

Contact:
Phone:
Fax:
Email:
Ms. SHANSONG JUFU CHEM TECH
86-531-88987705
86-531-88987705
Send Inquiry
Shandong Jufu Chemical Technology Co., Ltd.
Bld. 4-1001, No. 2177, Tianchen Rd., Jinan, Shandong, China
Jinan 250000
China
3/21/22 6:32 GMT
sell Hexanoyl Dipeptide-3 Norleucine Acetate

Name: Hexanoyl Dipeptide-3 Norleucine Acetate Reference: PerfectionPeptide P3 Grade: cosmetic Purity: >95% Source: synthetic MSDS and COA: available for your reference Recommended use level: 0.5 – 3 % (corresponds to 0.5 – 3 ppm of pure peptide) Capacity: 200g per month Appearance: white powder 2.Mechanism of Hexanoyl Dipeptide-3 Norleucine Acetate 3.Functions:Speeds up cell renewal for a fresher and more vibrant skin Smoothes the skin micro-relief Hydrates the skin intensely Refines skin texture and reduces wrinkle depth For a more uniform skin that reflects light with new radiance 4.Description: PerfectionPeptide P3 Makes the skin recover its original desquamating potential. PerfectionPeptide P3 is a biologically active tripeptide which reactivates the natural desquamation process of the skin.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
Leslie Cheng
+86 19181987467

Send Inquiry
Chengdu Youngshe Chemical Co.,Ltd
2-501, building 10, No. 77, Tianmu Road, hi tech Zone, Chengdu, Sichuan, China
Chengdu
China
3/21/22 6:29 GMT
sell Dipeptide-2

INCI Name: Dipeptide-2 Cas No.24587-37-9 Reference: DermaPep A210 Formula: C16H21N3O3 Molecular: 303.36 Purity: >95% Grade: cosmetic Source: synthetic MSDS and COA: available Appearance: white powder 2.Usage: Dipeptide-2 increases lymphatic circulation, prevent puffiness and reduce bags under eye 3.Description: Dipeptide-2 is used primarily in eye creams. It improves lymphatic circulation and helps the skin clear away toxins. It’s especially effective for drainage of under-eye bags, spider veins and rosacea.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
Leslie Cheng
+86 19181987467

Send Inquiry
Chengdu Youngshe Chemical Co.,Ltd
2-501, building 10, No. 77, Tianmu Road, hi tech Zone, Chengdu, Sichuan, China
Chengdu
China
3/18/22 9:44 GMT
Water Soluble Nonionic Polyacrylamide Coagulant Flocculant NPAM

Polyacrylamide(also called PAM). It is a linear high molecular polymer and one of the widely used water-soluble high molecular polymers. According to ionic characteristics, it can be divided into anionic polyacrylamide (APAM), cationic polyacrylamide (CPAM) and non-ionic polyacrylamide (NPAM). It can be widely used in water treatment, papermaking, petroleum, coal, mining and metallurgy, geology, textiles and other industrial fields. Product name Nonionic Polyacrylamide High Molecular Weight Coagulant Flocculant NPAM Safety Harmless non-flammable Solid content ≥90 Degree of hydrolysis about 15% Shelf Life 1 Years Proper Storage Application field Wastewater treatment in sand washing plant Package 25kg/bag Place of origin Henan, Chia

Contact:
Phone:
Fax:
Email:
Mr. Lee
86-0371-64439055
86-0371-64439055
Send Inquiry
Henan Saifu Trading Co., Ltd.
Block B, Zhihui City, Songshan Road, Gongyi City, Henan Province
Gongyi 451200
China
3/18/22 2:33 GMT
Rutile Grade Sulphate Process Titanium Dioxide SR-2377 For Paint

Classifications:ISO591-1:2000(E): R2 ASTM D 476-00: Ⅴ SR-2377 is a rutile titanium dioxide pigment produced by zircon, alumina inorganic and organic surface treated, designed to give the good whiteness,excellent gloss, high tinting strength, super durability and good dispersion properties. Applications:Widely used in Interior/exterior coatings, Emulsion paints, Powder coatings, Ink, Primer paints, Paper, Rubber, Master batch, Plastics Package: Packed by paper bag with net weight 25 Kg, 500 Kg and 1000 Kg as customer’s choice. Notes: Please feel free to contact us to obtain the detailed manual. Qingdao Botian Chemical Co., Ltd belongs to Qingdao Tida International Trade Co., Ltd, founded in 2003,.After eighteen years of technological and scientific innovation and production line management, we have became the leading company of Titanium Dioxide products , PVC Paste Resin products production and international sales company. Main products include over a dozen kinds of high-precision chemical products which are chloride process and sulphate process Titanium Dioxide,Titanium Oxychloride, Titanium Tetrachloride, High Titanium Slag, PVC Paste Resin, Caustic Soda etc. With a professional, tight, young technology R&D team, making the product has a high precision and purity of scientific evidence and quality guarantee.

Contact:
Phone:
Fax:
Email:
Ms. Susan
86-532-89088572
86-532-89088579
Send Inquiry
Qingdao Tida International Trade Co., Ltd.
13# 101 Hengda Yulan Guoji, No-702 Shanhe Rd., Chengyang District,Qingdao,China
Qingdao 266000
China
3/15/22 6:01 GMT
SHMP CAS:10124-56-8 Sodium Hexametaphosphate Tech And Food Grade Used In Wa

Uses: For industrial use, such as oil field, paper-making, textile, dyeing, petrochemical, tanning, metallurgical and building material industry, it is mainly used as a water softening agent in solution fot printing, dyeing, and boiler; Diffusant in papermaking; slow corrodent, floating agent, dispersing medium, high temperature agglomerant, detergent and soil analytical chemical reagent, For food grade, it is mainly used as additive agent, PH adjusting agent ang fermentation agent, and nourishment. Packing and storage: In 25kg, 50kg, 1000kg net bags, store at a cool, dry and well ventilated place. Shelf life 24 months. Molecular formula: (NaPO3)6 CAS:10124-56-8 Molecular weight: 611.82 Standard executed: HG/T2519-1997(TG)/GB/T1890-2005(FG) Properties: Free flowing white powder, Specific gravity is 2.484(20℃), easily soluble in water, but not in organic solution, absorbent to dampness, and turn sticky when absorbed dampness in air. It is possible to form solvent compound with metallic ions such as Ca, Ba, Mg, Cu and Fe, It is a fine agent for water treatment.

Contact:
Phone:
Fax:
Email:
Ms. Catherine
86-152-82870622
86-152-82870622
Send Inquiry
Sichuan Kangzehongyun International Trade Co., Ltd.
Room 07, 16 / F, Section N2,Global center, High-tech Zone, Chengdu City,Sichuan Province,P.R.China.
Chengdu 610000
China
3/11/22 7:05 GMT
Thermoplastic Solid Acrylic Resin BA-66 Similar To DEGALAN LP 66/02N

Representative property: Appearance White Powder Solid content 100% Softening point 130 ℃ min Vitrification temperature 50 ℃ max Molecular weight 70000 max Resolvable: It can be dissolved in ester kind, ketone kind solvent, can not be dissolved in the alcohol kind and 200# gasoline solvent. Character: 1, Good adhesion and flexibility; 2, Good dispersivity and leveling; 3, Good chemical,water and alcohol resistance; 4, Good compatibility with Chlorinated rubber or High Chlorinated Polyethylene or CPVC, CAB or NC; Application: 1, Soft plastic paint. 2, plastic coating. 3, gravure inks. 4, marine coating. Packing: 25kgs / bag Storage: Storage in the place where is dry and instailed with ventilation equipment, not in wet place. Its shelf life is 2 years.

Contact:
Phone:
Fax:
Email:
Linda Qiang
86-551-63523918
86-551-63517768
Send Inquiry
Briture Co., Ltd.
Room 1306, Block C, Blue Ocean building, Qianshan Road, Hefei, China.
Hefei 230000
China
3/10/22 7:33 GMT
Sn42Bi58 Pure Tin Low Temp Lead Free Solder Bar Tin Bismuth Environmentally

Environmentally friendly lead-free low temperature tin bar Tin-bismuth solder bar This product is a high-temperature-resistant solder bar with high purity, oxides, less dross, no film chips, no sections, bright, fast soldering, good wettability, and fast soldering. Suitable for tin on the feet of high temperature resistant components. 1.Features: 1. Fast melting speed 2. Good wettability 3. Good continuous weldability 4. Good diffusion 5. High economy 2.Scope of application: 5G base station peripheral materials Automobile industry New energy industry Computer peripheral industry Communication industry Audio industry 3.Product parameter: Brand TUOPU product name Lead-free low temperature solder bar Appearance bright, light yellow Material Sn/Bi Melting point 138±2℃ Length 338mm Shape strip, rod Single weight about 0.7kg Packing specification 20kg/box model Sn42Bi58 Packing Carton custom made According to customer process requirements

Contact:
Phone:
Fax:
Email:
Mr. Zhang
86-510-83796382
86-510-83793793
Send Inquiry
Wuxi Tuopu Chemical Co., Ltd.
No. 280, Xigang East Road, Xibei Town, Xishan District, Wuxi City
Wuxi 214000
China
3/10/22 2:01 GMT
Hydroxypropyl Methyl Cellulose HPMC Chemical 200000 Viscosity For Detergent

1. Construction: As the water-retaining agent and retarder for cement mortar, HPMC make the mortar have pumping ability. Use mortar, gypsum,putty powder , or other building materials as adhesive to improve drawing models and extend operable time. Use as adhesive tile, marble, plastic decoration, and adhesive reinforcement, also can reduce the amount of cement. The water retention of HPMC ensures that the slurry will not crack due to drying too quickly after application, thus enhancing the strength after hardening. 2. Coating: As a thickening agent, dispersant and stabilizer in the coating industry, it has good solubility in water or organic solvent. 3. Ceramic manufacture: Widely used as an adhesion in the manufacture of ceramic products. 4. Detergent: Our HPMC products are also suitable for the productin of laundry powder and the thickening of daily chemical products such as laundry liquid and shampoo. 5. Other: Can also be used in ink printing, PVC, leather, paper products and other industries.

Contact:
Phone:
Fax:
Email:
Lily
86-139-30417802
86-311-84455168
Send Inquiry
Jinzhou City Yuming Trading Co., Ltd.
JINZHOU CITY, HEBEI PROVINCE, CHINA
JINZHOU 052200
China
3/9/22 9:16 GMT
Impreganted Paper Anti Blocking Additive Agent Durable ISO9001

Brand name FENTENG Classification Chemical Auxiliary Agent Other Names Impregnated paper additives Place of Origin Guangdong ,China Usage Paper Chemicals, Surfactants Application For Impregnated paper making Appearance light yellow transparent liquid Product name Dispersant Additive Type Surfactant Mixture Model Number RP201 Shelf Life 1 YEAR MOQ 1Ton (simple is free) Packaging Details 1000kgs per IBC drumor 200kgs per plastic drum if you want to know more about the product ,please contact with us ,we will reply to you in 24 hours. PRODUCT INTRODUCTION FENTENG AS200 is an anti-stick agent for impregnated paper, which can effectively prevent the adhesion of urea-formaldehyde resin and melamine formaldehyde resin impregnated paper. It can effectively prevent urea- formaldehyde resin from penetrating into the surface of melamine resin.

Contact:
Phone:
Fax:
Email:
Mrs. Ada
86-0757-87278170
86-0757-87278170
Send Inquiry
Fenteng Fine Chem Tech(Foshan) Co.,Ltd
F4 3-1 Kaiyuan Road,Datang Industrial Park, Sanshui District, Foshan City,Guangdong Province,China
Foshan 528000
China
3/7/22 9:16 GMT
Reactive Dyes Textile Auxiliary Agent For Cotton Linen Viscose Ph7

Intensifier deep agent-- Physical properties: Appearance milk white liquid PH value(1%water liquor) 4 - 7 Specific gravity (20℃) 0.98g±0.05 Solubility easy disslove cold water       Application and character : The product fit for all kinds of synthetic fibre and natural fibre dipping ,gaddin gartifactitious.It could endue fabric excellent adden deepless,adden colourful and adden shiny effect ,but couldn`t infection fabric color fasten and shine fasten. Use ways: 1.Dose Commonly dose is 10-50g/L.About the detail dose,the factory should according as oneself fact (as color dark, dyestuff concerntration ),adjust dose by sample. 2.Technical flow dyeing→washing → darken (gadding )→drying→other finishing 3.Attention   ① After dyeing,should washing with enough water ,for fear remainder agent infection effect .   ② Adden deepless process,should try best control the same with every time ,for fear making color difference.   ③ Adder dose,bigger add deepless,darken process should first after dyeing ,couldn't compound use with other finishing.   ④ We could proper add the time of dipping if fabric thicker (or adden a litter special filter agent ),adden deepless effect shall better.

Contact:
Phone:
Fax:
Email:
Mr. shaw
86-139-12376797
86-139-12376797
Send Inquiry
INTRACHEM CO.,LTD
Wuyun Road, huishan, wuxi, jiangsu province, China
Wuxi 214000
China
3/4/22 8:08 GMT
100 Tests CFDNA Extraction Kit For Next Generation Sequencing

High quality nucleic acid is the guarantee for genomics research. BunnyTeeth Technology uses superparamagnetic bead purification technology to provide users with a highly sensitive nucleic acid extraction solution that easily achieves trace nucleic acid extraction for low concentration. As verified by thousands of clinical samples, BunnyMag cfDNA Extration Kit for Next Generation Sequencing 25/50/100 tests can extract high quality cfDNA from cell-free body fluids such as fresh or frozen plasma, serum, pleural fluid, ascites and cerebrospinal fluid for scientific research and clinical in-vitro diagnostic use. Packing Content Main components Lysis Binding Buffer Guanidine isothiocyanate, 5 M Washing Buffer 1 Guanidine isothiocyanate, 3 M Washing Buffer 2 Ethanol absolute, 80% Proteinase K 20 mg/mL Proteinase K Magnetic Beads Nano-magnetic beads

Contact:
Phone:
Fax:
Email:
Mr. zhu
86-152-95035903
86-152-95035903
Send Inquiry
BunnyTeeth Technology Inc.
Unit A, Zhongdan Bioscience Industrial Park, Jiangbei New District, Nanjing, Jiangsu, China
Nanjing 210000
China
3/3/22 3:21 GMT
MODIFIED HISTONE

As a professional peptide company in China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, from ug to g with 70% to 99% purity, can also be made according to your requirements. Modified histones can be applied to nucleosome assembly and the subsequent study of biochemical function and structure. Histones are proteins that condense and package DNA neatly into chromosomes. Different types of histone modifications affect different processes in the cell such as the activation/ inactivation of transcription, chromosome packaging, DNA damage and DNA repair. The histone modifications is an important post- translational process that plays a key role in gene expression. Histone modifications impact gene expression by changing the structure of chromatin or through the recruitment of histone modifiers. Histones pack DNA into structures called nucleosomes, to fit the DNA molecule into the nucleus. Each of these nucleosomes has two subunits, each comprising the core histone H2A protein, histone H2B protein, histone H3 protein and histone H4 peptide, and a linker histone called H1 that acts as a stabilizer. If you want to know the process of peptide manufacturing, please contact us.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:16 GMT
MAMBALGIN 1

ASIC1 channels, Mambalgin 1 is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. 1609937-15-6 Product Name Mambalgin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 6554.5 Da Molecular formula C272H429N85O84S10 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETEN , NKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) APPLICATION OF MAMBALGIN 1 Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells. As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us. More information about our pre clinical trial, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:14 GMT
L CARNOSINE

L Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs in high concentrations in muscle and brain tissue. SPECIFICATION OF L CARNOSINE Purity(HPLC) ≥98% Content ≥99% 20% below market price 1000+kg per month Fast delivery APPLICATION OF L CARNOSINE Product Name L-Carnosine β-Alanyl-L-histidine H-β-Ala-His-OH CAS-No. 305-84-0 Molecular Formula C9H14N4O3 Sequence β-Ala-His Molecular Weight 226.232g/mol Package 1kg, 25kg, customizable Appearance White powder Application Cosmetic raw materials Storage 2~8℃ Efficacy and Mechanism of Action: Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water- borne antioxidant with wound healing activity and naturally occurs in high concentrations in muscle and brain tissue. Carnosine is an unsaturated aldehyde that scavenges reactive oxygen species and peroxidizes fatty acids in cell membranes during oxidative stress. Low molecular weight water-soluble unmodified dipeptide-Ala-His has very little affinity for skin and does not penetrate beyond the first layer of cuticle. However, the lipophilic peptide palmitoyl-Ala-His diffused into the cuticle, epidermis, and dermis, and no systemic activity was observed. If you want to know more about l carnosine price, please contact us. As a peptide supplier, we will produce more high quality products for customers, if you have needs, please contact us. More information about our chemical structure identification, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China


SOURCE: Import-Export Bulletin Board (https://www.imexbb.com/)
Result Page:   << Previous   |   52  |   53  |   54  |   55  |   56  |   57  |   58  |   59  |   60  |   61  |   62  |   Next >>

Post an Offer to Sell
Home - Offers to Buy - Business Opportunities - Company Profiles

© 1996-2026 IMEXBB.com. All rights reserved.

IMEXBB.com