Other ChemicalsHome > Offers to Sell > Chemicals & Plastics > Other Chemicals
3/3/22 3:13 GMT
KURTOXIN
SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. 820959-57-7 Product Name kurtoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 7386.36 Molecular formula C324H478N94O90S8 Source Peptides Synthesis Storage Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence KIDGYPVDYW NCKRICWYNN KYCNDLCKGL KADSGYCWGW TLSCYCQGLP DNARIKRSGR CRA (Modifications: Disulfide bonds: 12-61, 16-37, 23-44, 27-46) APPLICATION OF KKURTOXIN Kurtoxin, a 63-amino acid peptide stabilized by four disulfide bonds, is the first reported peptide inhibitor of T-type voltage-gated calcium channels If you want to know more about peptide polypeptide, please contact us. Contact:
Phone: Fax: Email: Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China Anhui 230031 China 3/3/22 3:12 GMT
KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels. SPECIFICATION OF KALIOTOXIN CAT K1070-V CAS NO. 145199-73-1 Product Name Kaliotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4149.89 Da Molecular formula C171H283N55O49S6 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) APPLICATION OF KALIOTOXIN Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system. As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about peptide library, please visit our website. Contact:
Phone: Fax: Email: Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China Anhui 230031 China 3/3/22 3:09 GMT
SPECIFICATION OF IBERIOTOXIN
CAT K1060-V CAS NO. 129203-60-7 Product Name Iberiotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4230.9 Da Molecular formula C179H276N50O56S7 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) APPLICATION OF IBERIOTOXIN Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel. As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about synthetic route, please visit our website. Contact:
Phone: Fax: Email: Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China Anhui 230031 China 3/2/22 3:54 GMT
750g Sausage Construction Silicone Sealant Glue RTV Epoxy Resin Structural
Application Tips To obtain a smooth and neat finish, apply masking tape and remove before sealant cres. Paint surfaces completely before applying sealant. Before processing, observe the instructions in our product leaflets and safety data sheets. Product Description GP Acetic cure Silicone Sealant is a one-part, acid and moisture cure, medium modulus silicone sealant that provides durable, pliable, watertight joints and offers outstanding adhesion without priming to most non-porous substrates. Material preparation: For successful bonding, glass must be clean of all dust, dirt and oil. The cleaned glass should be wiped dry immediately with a clean, lint free cloth or blown dry with hot oil free air. DO NOT clean glass with soap and water solutions. Soap residue can cat as a release agent and result in adhesion failure. Clean glass should be handled with clean, lint free gloves or equivalent only. Oils from hands and fingers can act a release agents resulting in adhesion failure. Contact:
Phone: Fax: Email: linqu yuanyang adhesive industry co.,ltd.
Donghuan Road, Linqu County, Weifang City, Shandong Province Weifang 261000 China 3/2/22 2:50 GMT
400g Medical Treatment For Pain Relief Reusable Ice Packs
Tips: There are four main characteristics of the pharmaceutical cold chain: 1. Security In the evaluation of pharmaceutical cold chain transportation services, safety is at the forefront, which is determined by the particularity of logistics objects. 2. Sudden demand Due to the sudden outbreak of too many diseases, which are easily contagious and spread rapidly, the demand for refrigerated medicines is of a sudden nature, which requires high emergency service capabilities of logistics providers. 3. High cost Compared with the cost of ordinary transportation, the cost of cold chain transportation is generally about 80% higher 4. Professionalism The transportation and storage of medicines must be operated within a specific temperature range in accordance with national regulations, and in-transit GPS management must be implemented to achieve traceability of refrigerated medicines. Introduction to use: Cold compress: put it in freezer or freezer (-10℃ -- 20℃) for more than 30 minutes before use. Hot compress: wrap the cold and hot bag with a slightly wet towel, put it into the microwave oven and turn it to medium heat. Heat it for the first time within 60-100 seconds, and feel whether the temperature is appropriate after taking it out. If it is not hot enough, continue heating every 10-20 seconds until it is warm enough. If continuous use, subsequent heating time control in 50-60 seconds (medium heat). Hot water: Soak hot and cold bags in boiling water for about 4 minutes, or reheat for another 1 minute if the temperature is not enough. Contact:
Phone: Fax: Email: Sichuan Aishipaier New Material Technology Co., Ltd.
Room 2010, 20th Floor, IMP Global Metropolis Plaza, No. 318, Dongda Road, Jinjiang District, Chengdu, Sichuan, China Chengdu 610000 China 2/10/22 7:07 GMT
Usnic Acid Pure Plant Extracts , 98% Usnea Lichen Extract Cosmetic Raw Mate
Usnic Acid Powder 98% Usnea Lichen Extract Cosmetic Raw Materials Usnic Acid Usnic Acid are the usnea Extract powder, also called Lichen Extract, Usnea Barbata Extract, comes from the Dry Lichen of Usnea longissima. General ingredient content: Usnic Acid (Usninic Acid) 98%. The yellow crystalline powder is widely used in curing wounds and burns, antibacterial and antisepsis as the raw material of toothpaste, cosmetics, pharmaceuticals, and perfume. Usnic Acid Pure Plant Extracts , 98% Usnea Lichen Extract Cosmetic Raw Materials 0 Analysis Specification Result Test method Assay Usnic Acid 98% Usnic Acid 98% HPLC Solvent Water Water Complies Identification Positive Positive TLC Appearance Yellow Powder Complies Visual Odor Characteristic Characteristic Organoleptic Particle size 100% through 80 mesh 80 mesh 80 Mesh Screen Loss on drying 5% Max Complies 5g / 105C /2hrs Ash Content 5% Max Complies 2g / 525C /3hrs Heavy metals 10ppm Max Complies Atomic Absorption Pb 2ppm Max 1.28ppm Atomic Absorption Cd 1ppm Max 0.1ppm Atomic Absorption Hg 0.1ppm Max 0.01ppm Max Atomic Absorption Microbiology Total plate count 10000cfu/g Max Complies AOAC Yeast & Mold 1000cfu/g Max Complies AOAC E. Coli Negative Negative AOAC Salmonella Negative Negative AOAC Function: 1. It is a kind of spectrum antibiotic,inhibit most gram-positive bacteria. 2. Usnic Acid also has inhibition function to the trichomonas vaginalis. 3. It has a certain curative effect to cure cervical inflammation,perineal rupture, dysentery and skin disease. 4. It is used as an antibacteria agent in cosmetics and ointments to prevent skin infection. It is also used in formulating deodorant, mouth-care products. Usnic Acid Pure Plant Extracts , 98% Usnea Lichen Extract Cosmetic Raw Materials 1 Application: 1. Pharmaceuticals Usage : Usnic Acid has a selective inhibitory effect on streptococcus, the main bacterium causing oral diseases and dental caries. Usnic Acid is effective for various skin diseases such as burns, infections, and psoriasis. It can improve the symptoms of tuberculosis and intestinal tuberculosis, and even make the microscopic examination of tuberculosis bacteria negative. Used for purulent wounds, burns and skin infections. It has analgesic and antipyretic effects. Usnic Acid has similar effects to antiviral drugs, antiprotozoal drugs,antiproliferative active drugs and anti-inflammatory drugs. Usnic Acid can be used as a preservative. 2. Cosmetics usage: Usnic Acid is a broad-spectrum antibiotic, used as a highly effective preservative in cosmetics. Contact:
Phone: Fax: Email: Xi'an Spring Biotechnology Co., Ltd.
Room 1508, Digital Building, No. 8 Keji 5th Road, Yanta District, Xi'an City, Shaanxi Province Xian 710000 China 1/19/22 3:31 GMT
High Light Transmittance LED White Light Diffusing Powder For Polycarbonate
LED White Light Diffusing Powder With High Light Transmittance For Polytech Masterbatch / Polycarbonate Product Description KS-200 is a silicone plymer resin powder and a kind of effivient LED/LCD light diffusion agent. It's mainly applied to PC, PVC, PMMA ,Color Masterbatch and functional Masterbatch, PET transparent resin and LED. It is effective to increase of light scattering and transmission and emit soft and beautiful light which build a light and comfortable effect. High Light Transmittance LED White Light Diffusing Powder For Polycarbonate 0 Feature 1. Temperature resistance above 300℃, aging resistance, no yellowing, no black spots; 2. High light transmittance, energy saving; less addition and low cost; 3. Narrow particle size distribution and stable optical index; 4. High haze makes the dazzling incident light turn into unobtrusive soft light; 5. Low light loss and high light diffusion efficiency can fully meet the requirements of higher brightness and energy saving of LED lighting, packaging, light diffusion film, etc; 6. In transparent materials such as PC, pet, PMMA, PS and PVC, 0.5-1% of the additive amount can reach more than 86% of the light transmittance and more than 90% of the haze. Application PC,PMMA,PS,ABS and PVC lampshade,light diffusion plate, LED light emitting resin, electronic display board, digital tube lattice, luminous word, cosmetic bottle and color masterbatch or functional masterbatch How to use This product has good dispersion in the resin and directly added into pellets; the dispersion uniformity is better if coating silica bead and precoating liquid. Contact:
Phone: Fax: Email: Guangzhou Batai Chemical Co., Ltd.
Room 1101, Building A2, Xinggang International, Country Garden, Xinhua Town, Huadu District, Guangzh Guangzhou 510800 China 1/14/22 7:04 GMT
C10H14O5 AAEMA Monomer Reduced Resin Viscosity Methacrylic Monomer
AAEMA Monomer Methacrylic Monomer Reduced Resin Viscosity Product Description AAEM readily polymerizes with other acrylic and methacrylic monomers. It is a methacrylic monomer used to formulate high-solids solution acrylic resins and acrylic emulsions for lower VOC emission industrial and architectural coatings. Chemical name Concentration Additional identification 2-(acetoacetoxy)ethyl methacrylate >95% CAS-No.: 21282-97-3 EC No.: 244-311-1 2-hydroxyethyl methacrylate <5% CAS-No.: 868-77-9 EC No.: 212-782-2 INDEX No.: 607-124-00-X The ability of AAEM to react with amines and hydrazides makes it an ideal monomer for self-crosslinkable, room temperature cure acrylic emulsions. It also finds use in acetoacetylated polymers crosslinked through chelation with metal ions and for acetoacetylated polymers for producing colorfast fibers. Product Features — Improved adhesion to metal substrates — Low glass transition temperature for improved coating flexibility — Outstanding flexibility and corrosion resistance — Reaction with conventional crosslinkers — Resin viscosity reduction for lower VOC emissions — Room temperature cure, isocyanate-free crosslinking Product Key Applications — Acetoacetylated polymers — Adhesive polymers — Cosmetic polymer intermediate — Pharmaceutical intermediate — Reactive monomer for UV cure applications — Self-crosslinkable acrylic emulsions Contact:
Phone: Fax: Email: ShenZhen Prechem New Materials Co.,Ltd
Room 3108, Block A, Electronic Technology Building, No. 2070, Shennan Middle Road, Shenzhen, China Shenzhen 518000 China 12/29/21 6:48 GMT
solid abrasives
We're supply D-36 The finishing abrasive, It's a solid square abrasive in blue, It's used for gold, silver, platinum, and white gold. Especially white precious metals such as white gold. It is excellent for the side gloss of the frames of glasses. thod of use Rotate the buff attached to the motor or handpiece to apply the light medicine and use it. We are Supply and sale regardless of quantity from small to large. In addition to D-36, we also deal with S&TY-402N(Old name:D-24), S&TY-404N(N-5000) Minimum Order: 10 long tons Contact:
Phone: Fax: Email: senforce
http://www.senforcetrading.com/bbs/board.php?bo_table=s2_1&sca=Surface%20Treatment yongin 16954 Korea (South) 12/27/21 8:07 GMT
2000C First Rate Saturated Polyester Resins Excellent Mechanical Property
First-rate Economical Polyester Resin NH9306 with Excellent Mechanical Property and Weathering Resistance ◇ Applications: NH-9306 is a carboxyl polyester resin designed for 93/7 polyester/TGIC powder coatings to be cured at 200℃. ◇ Basic features: Excellent weathering resistance Good storage stability Improved mechanical properties compared with NH9307 ◇ Specifications: Appearance: light yellow or white transparent flakes Color(50%DMF) max:3 Acid number(mgKOH/g): 30-36 Softening point(℃): 101~113 Glass transition temp.( ℃): ~62 Melting viscosity(mPa.s200℃): 5000±1500 Reactivity at 180℃(s, 7% TGIC): 180±60 ◇ Recommend Formulation:NH9306—TGIC NH-9306 TGIC Filler & pigment Leveling agent Benzoin 200 15 140 2.4 1.2 ◇ Extrusion Condition: Two-screw extruder Zone I: 90~110℃ Zone II: 110~120℃ Speed of revolution: 500-1200 rpm Fineness of powder: <100μm ◇ Application Condition: Electrostatic spraying with: 40~70KV Degreased cold-rolled steel: 0.5mm Film thickness: 50~70μm ◇ Curing Requirement: 200℃×15 min ◇ Film Properties: Gel time (180℃, s): 200-350 Flow(180℃,mm): 24~28 Gloss(60°): ≥85% Adhesive(1mm,grade): 0 Pencil hardness: ≥1H Bending (φ1mm): Pass Impact: pass 50 kg·cm ◇ Packaging: PE bags, N.W. 25KG±0.1KG / bag Contact:
Phone: Fax: Email: Kinte Materials Science and Technology Co.,Ltd
16th Yufeng Road, HuaDu District , Guangzhou,China Guangzhou 510000 China 12/13/21 8:31 GMT
Sodium Dichloroisocyanurate
Sodium dichloroisocyanurate disinfectant, sodium dichloroisocyanurate sdic is a kind of disinfectant. The product has high efficiency and constant performance and has no harm to human beings. It enjoys a good reputation both at home and abroad. SDIC China , as a new high-efficiency special disinfectant for swimming pool and sauna water treatment, can quickly kill intestinal pathogenic bacteria, pyogenic coccus, pathogenic yeast, and inactivate viruses. The effect is stable and long-lasting. HS-CODE: 2933 6929 10 Un No.: 2465 Molecular weight: 219.65 Formula: C3O3N3Cl2Na CAS No.: 2893-78-9 Specification of Sodium Dichloroisocyanurate Feature and Advantage of Sodium Dichloroisocyanurate Strong sterilization. Safe and convenient to use. Wide sterilization range Strong disinfection ability. Non-toxic and harmless. Application of Sodium Dichloroisocyanurate 1. This product can be used in swimming pools, drinking water, industrial circulating-cooling water treatment. 2. It can be used in the disinfection of tableware, sterilization of houses, hotels, hospitals, and public places. It can also be used in environment disinfection of feeding fish, silkworm, livestock, and poultry. 3. Sterilization: Disinfecting in hospital, family, hotel, public place, pharmaceuticals, breeding industry. 4. Moreover, it can be used in shrinkage resistance and weaving of wool, bleaching of textile, and chlorination of rubber. Cautions of Sodium Dichloroisocyanurate 1. Contact with combustible material may cause a fire. 2. SDIC is corrosive, with an irritating smell, and burns to eyes, eye film, skin, etc. contact with the human body is strictly prohibited. In case of accidental contact, it should be washed with water in time, and sent to the hospital for treatment in case of serious contact. 3. Operators should wear protective glasses, rubber gloves, and other labor protection articles. As a sodium dichloroisocyanurate factory, sodium dichloroisocyanurate manufacturer, Rosun has always been adhering to the core development concept of science, quality, health, and environmental protection, adhering to the sacred mission of "Makes The Rivers And Earth Cleaner, Helps Billions Of People Be Healthier.", serving the society, serving the cause of human environmental protection and health! If you want to know more information about our disinfectant factory, please visit our website. Minimum Order: 1 bags Contact:
Phone: Fax: Email: Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China Sichuan 610100 China 12/13/21 8:30 GMT
Skin Disinfectant
Skin disinfectant solution meets WHO guidelines on hand hygiene in health care, liquid type with 50ml,100ml& 500ml package. Application: Surgical hand disinfection, skin disinfection at the injection site, and general object surface disinfection. Germs Killing Rate: 99.999% Double high-efficiency sterilization formula, the effect is safe and reliable, spray type, no-wash quick-drying, quick effect, unique skincare factor, deep care of the hand skin, moisturizing and not drying. chlorhexidine acetate& ethyl alcohol double sterilization and long-term bacteriostasis. Types of Skin Disinfectant 500ml Skin Disinfectant Product usage is efficient against hand intestinal pathogen, pyogenic coccus, saccharomytes, and common pathogens. 100ml Skin Disinfectant Efficient against hand intestinal pathogen, pyogenic coccus, saccharomyces, and common pathogens. 50ml Skin Disinfectant Efficient against hand intestinal pathogen, pyogenic coccus, saccharomyces, and common pathogens. What Is The Principle of Disinfection? Change the permeability of the cell membrane of pathogenic microorganisms. Interfere and destroy the enzyme system of pathogenic microorganisms. The protein of pathogenic microorganisms is coagulated and denatured. Inhibition of bacterial metabolic enzyme system. As one of the reliable disinfectant manufacturers, we also have disinfectant safe for skin for sale, if you have needs, please contact us. Minimum Order: 1 bags Contact:
Phone: Fax: Email: Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China Sichuan 610100 China 12/13/21 8:29 GMT
Roxycide for Veterinary Disinfection
Advantages of Roxycide Veterinary Disinfectant Products Activated Oxygen + Hypochlorous Acid for continuous long term activity and efficacy against biofilms Fast Acting, killing most pathogens within 5 to 10 minutes Wide applications and compatible with standard application methods - surface spray, water systems, nebulizers, aerosol Non-toxic and non-irritant at recommended dilutions Biodegradable and environmentally friendly Solution stable for 7 days. Video of RoxycideTM for Veterinary Disinfection Roxycide™- A Trusted Shield for Farm Disinfectant Prevention: Proven Efficacy Against Bacteria, Virus, Fungi High Quality Disinfectant Fast Acting High Activity Against Biofilms The Disinfectant Safe for Animals Owns Wide Applications: Surface, Aerial, Water Livestock Environmentally Friendly Poultry, Swine, Aquaculture, Pet, Dairy, Industrial Roxycide™ Disinfectant in Poultry Farm Applications The Roxycide disinfectant has many usages, which makes it not only a disinfectant used in poultry farm. Roxycide™ Vet Disinfectant Activity Spectrum Roxycide disinfectant powder disinfects livestock housing, surfaces, and equipment. It has been proven effective against more than 500 strains of viruses, bacteria and fungi including African Swine Fever, Foot and Mouth Disease, (FMD), Avian Influenza, Salmonella, and Campylobacter. Roxycide™ Veterinary Disinfectant Cleaner Application Strategies How to make a ready-to-use disinfectant solution? Recommendations for Disinfection Spary for Poultry Farm and Livestock Aerosol/Atomization disinfection using electric sprayer once every 1-2 days Dilution rate: 50 grams Roxycide™ powder to 10 liters of water Application rate: 20-40 ml per cubic meter Use electric aerosol sprayers during the hot season to reduce temperature and heat stress prevention Dilution rate: 20 grams Roxycide™ powder to 15 liters water Application rate: 60 ml per cubic meter During periods of animal stress or epidemic in presence of animals Dilution rate: 50 grams Roxycide™ powder to 10 liters water Application rate: 40 ml per cubic meter, 1-2 times per day for 3-5 days Note: In summer, suggest spraying in the early morning with closed ventilation Safety Do not exceed the equivalent of 5 grams of Roxycide™ powder per kg of body weight The Strategy of Roxycide for Veterinary Disinfection There are many disinfectant suppliers, but we are the best choice for you. Minimum Order: 1 bags Contact:
Phone: Fax: Email: Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China Sichuan 610100 China 12/13/21 8:28 GMT
Roxycide for Aquaculture Disinfection
Roxycide™ an activated oxygen disinfectant that provides solutions for four key challenges for the Aquaculture industry: Pathogen Control: a highly effective disinfectant against both bacteria and viral pathogens Biosecurity: an effective tool in the prevention of disease transmission and management Pond Ecology Management: a mode of action that donates oxygen to the water while helping to manage organic matter Eco-friendly: active constituents degrade to inert and safe substances allowing ongoing and extended usage in the presence of aqua species. Key Benefits in Aquaculture of Roxycide for Aquarium Disinfectant The high quality disinfectant has application flexibility to address key production stages including pond preparation, ongoing water management, and disease outbreaks. Increases oxygen levels in water to help sustain maximum production in ponds and maintain a sustainable pond ecology. Highly effective in the presence of organic matter. Highly effective in Aquaculture to control and eradicate bacteria, fungi, molds, and all viral families affecting Fish, Shrimp, Crab, and other Aquatics. The disinfectant for livestock is used to prevent bacterial diseases including gill-rot, white spot disease, ascites, enteritis, putrid skin disease, decayed crusta disease, saprolegniasis. Spectrum Applications of Roxycide for Fish Tank Sanitizer Roxycide for Aquaculture Disinfection Application Strategy of Roxycide for Aquaculture Disinfection Roxycide for Aquaculture Disinfection Roxycide™ Usage Instructions of Roxycide for Aquaculture Disinfection Do not attempt to pour Roxycide™ Powder directly into aqua ponds. Calculate the volume of water in the pond in cubic meters (m3). Select the desired application and dosage required from the table above. Calculate dosage depending on the volume of water in the pond. Always make a base/stock solution by dissolving the required quantity of Roxycide™ powder into fresh, air temperature water at a ratio of 1:100 for best results (example; 1kg Roxycide™ to 100 liters water). Use a clean container of sufficient size (example 200 liter drums or 1000 liter IBCs) To make the base/stock solution, mix the required amount of Roxycide™ powder into water, while stirring or agitating to helpfully dissolve Roxycide™ in the base solution water. Evenly distribute the base solution to the pond, ideally where there is water movement or aeration paddles to aid in dispersal. Clean and disinfect containers and equipment after. Storage of stock solution: 5-7days. Roxycide™ Application and Dosage Directions of Roxycide for Aquaculture Disinfection How to Sanitize a Fish Tank First, you should clean up the fish tank. next, put the aquaculture disinfectant in a spray bottle and use an 8:1 water/bleach ratio to make a spray. Spray the fish tank and clean it up. Then you leave the tank to dry. Once the tank has been left to dry for 24 hours, fill it with water. If the disinfectant contains chlorine, remember to add a de-chlorinator. Empty the tank and add the de-chlorinator again to make sure it is void of chlorine., and the tank is now ready to use. As a manufacturer of disinfectant, we have various products of disinfectant for sale, any needs, contact us. Minimum Order: 1 bags Contact:
Phone: Fax: Email: Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China Sichuan 610100 China 12/13/21 8:27 GMT
Personal Care
Rosun hand personal hygiene products, personal care products with a unique formula, the broad-spectrum killing of intestinal pathogens, pyogenic cocci, pathogenic yeasts, and other common hospital pathogens. With unique skincare factor, deeply nourishes hand skin, moisturizes not dry. One-way pump head aseptic design, easy to use, safe, and hygienic. Quick spray type, short action time, quick effect, little skin damage. Feminine Hygiene products with a safe and efficient antibacterial formula, which can quickly kill all kinds of common pathogens causing perineal red, swollen, hot, painful, itchy, and other infection symptoms. Oral Hygiene products with highly effective bactericidal ingredient dp300, 12 hours long-term antibacterial, professional prevention and treatment of various oral inflammation. Types of Personal Care Products Hand Sanitizer 500ml Hand Sanitizer Our 3D tempered glass is curved by precision hot bending machine with more larger radio on the edge and feels smooth. Hand Sanitizer Gel 100ml Hand Sanitizer Gel 500ml Hand Sanitizer Gel Waterless Hand Cleaner Gel Our 3D tempered glass is curved by a precision hot bending machine with larger radio on the edge and feels smooth. Skin Disinfectant 500ml Skin Disinfectant 100ml Skin Disinfectant 50ml Skin Disinfectant Our 3D tempered glass is curved by a precision hot bending machine with larger radio on the edge and feels smooth. Special Hand Wash 500ml Hand Wash Our 3D tempered glass is curved by precision hot bending machine with more larger radio on the edge and feels smooth. Child Friendly Hand Sanitizer Our 3D tempered glass is curved by a precision hot bending machine with larger radio on the edge and feels smooth. Feminine Wash Feminine Wash has the effect of cleaning, moistening, and sterilizing. Mouth Wash Rosun antiviral mouthwash can effectively against bacteria, fungi, and viruses. FAQ of Personal Care Why Is Personal Care Important? Good personal care/hygiene is one of the best ways to prevent disease. Handwashing with hand sanitizer gel can remove pathogenic bacteria. Good personal hygiene can also prevent diseases from spreading to others. Hand Hygiene Steps - Wash Hand What Disinfectant Is Safe For Chickens? What Is Water Treatment Steps? As personal care products company, personal care products manufacturer, we will attempt to meet all customers’ needs. We have personal care products wholesale, and the personal care products price is affordable if you have needs, please contact us. If you want to know more sorts of China disinfectant, please visit our website. Minimum Order: 1 bags Contact:
Phone: Fax: Email: Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China Sichuan 610100 China SOURCE: Import-Export Bulletin Board (https://www.imexbb.com/)
© 1996-2026 IMEXBB.com. All rights reserved.
|
|
||||||||||||||||||||||||||||||||||