Other ChemicalsHome > Offers to Sell > Chemicals & Plastics > Other Chemicals
3/4/22 8:08 GMT
100 Tests CFDNA Extraction Kit For Next Generation Sequencing
High quality nucleic acid is the guarantee for genomics research. BunnyTeeth Technology uses superparamagnetic bead purification technology to provide users with a highly sensitive nucleic acid extraction solution that easily achieves trace nucleic acid extraction for low concentration. As verified by thousands of clinical samples, BunnyMag cfDNA Extration Kit for Next Generation Sequencing 25/50/100 tests can extract high quality cfDNA from cell-free body fluids such as fresh or frozen plasma, serum, pleural fluid, ascites and cerebrospinal fluid for scientific research and clinical in-vitro diagnostic use. Packing Content Main components Lysis Binding Buffer Guanidine isothiocyanate, 5 M Washing Buffer 1 Guanidine isothiocyanate, 3 M Washing Buffer 2 Ethanol absolute, 80% Proteinase K 20 mg/mL Proteinase K Magnetic Beads Nano-magnetic beads Contact:
Phone: Fax: Email: BunnyTeeth Technology Inc.
Unit A, Zhongdan Bioscience Industrial Park, Jiangbei New District, Nanjing, Jiangsu, China Nanjing 210000 China 3/3/22 3:21 GMT
MODIFIED HISTONE
As a professional peptide company in China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, from ug to g with 70% to 99% purity, can also be made according to your requirements. Modified histones can be applied to nucleosome assembly and the subsequent study of biochemical function and structure. Histones are proteins that condense and package DNA neatly into chromosomes. Different types of histone modifications affect different processes in the cell such as the activation/ inactivation of transcription, chromosome packaging, DNA damage and DNA repair. The histone modifications is an important post- translational process that plays a key role in gene expression. Histone modifications impact gene expression by changing the structure of chromatin or through the recruitment of histone modifiers. Histones pack DNA into structures called nucleosomes, to fit the DNA molecule into the nucleus. Each of these nucleosomes has two subunits, each comprising the core histone H2A protein, histone H2B protein, histone H3 protein and histone H4 peptide, and a linker histone called H1 that acts as a stabilizer. If you want to know the process of peptide manufacturing, please contact us. Contact:
Phone: Fax: Email: Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China Anhui 230031 China 3/3/22 3:16 GMT
MAMBALGIN 1
ASIC1 channels, Mambalgin 1 is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. 1609937-15-6 Product Name Mambalgin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 6554.5 Da Molecular formula C272H429N85O84S10 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETEN , NKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) APPLICATION OF MAMBALGIN 1 Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells. As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us. More information about our pre clinical trial, please visit our website. Contact:
Phone: Fax: Email: Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China Anhui 230031 China 3/3/22 3:14 GMT
L CARNOSINE
L Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs in high concentrations in muscle and brain tissue. SPECIFICATION OF L CARNOSINE Purity(HPLC) ≥98% Content ≥99% 20% below market price 1000+kg per month Fast delivery APPLICATION OF L CARNOSINE Product Name L-Carnosine β-Alanyl-L-histidine H-β-Ala-His-OH CAS-No. 305-84-0 Molecular Formula C9H14N4O3 Sequence β-Ala-His Molecular Weight 226.232g/mol Package 1kg, 25kg, customizable Appearance White powder Application Cosmetic raw materials Storage 2~8℃ Efficacy and Mechanism of Action: Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water- borne antioxidant with wound healing activity and naturally occurs in high concentrations in muscle and brain tissue. Carnosine is an unsaturated aldehyde that scavenges reactive oxygen species and peroxidizes fatty acids in cell membranes during oxidative stress. Low molecular weight water-soluble unmodified dipeptide-Ala-His has very little affinity for skin and does not penetrate beyond the first layer of cuticle. However, the lipophilic peptide palmitoyl-Ala-His diffused into the cuticle, epidermis, and dermis, and no systemic activity was observed. If you want to know more about l carnosine price, please contact us. As a peptide supplier, we will produce more high quality products for customers, if you have needs, please contact us. More information about our chemical structure identification, please visit our website. Contact:
Phone: Fax: Email: Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China Anhui 230031 China 3/3/22 3:13 GMT
KURTOXIN
SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. 820959-57-7 Product Name kurtoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 7386.36 Molecular formula C324H478N94O90S8 Source Peptides Synthesis Storage Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence KIDGYPVDYW NCKRICWYNN KYCNDLCKGL KADSGYCWGW TLSCYCQGLP DNARIKRSGR CRA (Modifications: Disulfide bonds: 12-61, 16-37, 23-44, 27-46) APPLICATION OF KKURTOXIN Kurtoxin, a 63-amino acid peptide stabilized by four disulfide bonds, is the first reported peptide inhibitor of T-type voltage-gated calcium channels If you want to know more about peptide polypeptide, please contact us. Contact:
Phone: Fax: Email: Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China Anhui 230031 China 3/3/22 3:12 GMT
KALIOTOXIN
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels. SPECIFICATION OF KALIOTOXIN CAT K1070-V CAS NO. 145199-73-1 Product Name Kaliotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4149.89 Da Molecular formula C171H283N55O49S6 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) APPLICATION OF KALIOTOXIN Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system. As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about peptide library, please visit our website. Contact:
Phone: Fax: Email: Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China Anhui 230031 China 3/3/22 3:09 GMT
SPECIFICATION OF IBERIOTOXIN
CAT K1060-V CAS NO. 129203-60-7 Product Name Iberiotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4230.9 Da Molecular formula C179H276N50O56S7 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) APPLICATION OF IBERIOTOXIN Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel. As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about synthetic route, please visit our website. Contact:
Phone: Fax: Email: Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China Anhui 230031 China 3/2/22 3:54 GMT
750g Sausage Construction Silicone Sealant Glue RTV Epoxy Resin Structural
Application Tips To obtain a smooth and neat finish, apply masking tape and remove before sealant cres. Paint surfaces completely before applying sealant. Before processing, observe the instructions in our product leaflets and safety data sheets. Product Description GP Acetic cure Silicone Sealant is a one-part, acid and moisture cure, medium modulus silicone sealant that provides durable, pliable, watertight joints and offers outstanding adhesion without priming to most non-porous substrates. Material preparation: For successful bonding, glass must be clean of all dust, dirt and oil. The cleaned glass should be wiped dry immediately with a clean, lint free cloth or blown dry with hot oil free air. DO NOT clean glass with soap and water solutions. Soap residue can cat as a release agent and result in adhesion failure. Clean glass should be handled with clean, lint free gloves or equivalent only. Oils from hands and fingers can act a release agents resulting in adhesion failure. Contact:
Phone: Fax: Email: linqu yuanyang adhesive industry co.,ltd.
Donghuan Road, Linqu County, Weifang City, Shandong Province Weifang 261000 China 3/2/22 2:50 GMT
400g Medical Treatment For Pain Relief Reusable Ice Packs
Tips: There are four main characteristics of the pharmaceutical cold chain: 1. Security In the evaluation of pharmaceutical cold chain transportation services, safety is at the forefront, which is determined by the particularity of logistics objects. 2. Sudden demand Due to the sudden outbreak of too many diseases, which are easily contagious and spread rapidly, the demand for refrigerated medicines is of a sudden nature, which requires high emergency service capabilities of logistics providers. 3. High cost Compared with the cost of ordinary transportation, the cost of cold chain transportation is generally about 80% higher 4. Professionalism The transportation and storage of medicines must be operated within a specific temperature range in accordance with national regulations, and in-transit GPS management must be implemented to achieve traceability of refrigerated medicines. Introduction to use: Cold compress: put it in freezer or freezer (-10℃ -- 20℃) for more than 30 minutes before use. Hot compress: wrap the cold and hot bag with a slightly wet towel, put it into the microwave oven and turn it to medium heat. Heat it for the first time within 60-100 seconds, and feel whether the temperature is appropriate after taking it out. If it is not hot enough, continue heating every 10-20 seconds until it is warm enough. If continuous use, subsequent heating time control in 50-60 seconds (medium heat). Hot water: Soak hot and cold bags in boiling water for about 4 minutes, or reheat for another 1 minute if the temperature is not enough. Contact:
Phone: Fax: Email: Sichuan Aishipaier New Material Technology Co., Ltd.
Room 2010, 20th Floor, IMP Global Metropolis Plaza, No. 318, Dongda Road, Jinjiang District, Chengdu, Sichuan, China Chengdu 610000 China 2/10/22 7:07 GMT
Usnic Acid Pure Plant Extracts , 98% Usnea Lichen Extract Cosmetic Raw Mate
Usnic Acid Powder 98% Usnea Lichen Extract Cosmetic Raw Materials Usnic Acid Usnic Acid are the usnea Extract powder, also called Lichen Extract, Usnea Barbata Extract, comes from the Dry Lichen of Usnea longissima. General ingredient content: Usnic Acid (Usninic Acid) 98%. The yellow crystalline powder is widely used in curing wounds and burns, antibacterial and antisepsis as the raw material of toothpaste, cosmetics, pharmaceuticals, and perfume. Usnic Acid Pure Plant Extracts , 98% Usnea Lichen Extract Cosmetic Raw Materials 0 Analysis Specification Result Test method Assay Usnic Acid 98% Usnic Acid 98% HPLC Solvent Water Water Complies Identification Positive Positive TLC Appearance Yellow Powder Complies Visual Odor Characteristic Characteristic Organoleptic Particle size 100% through 80 mesh 80 mesh 80 Mesh Screen Loss on drying 5% Max Complies 5g / 105C /2hrs Ash Content 5% Max Complies 2g / 525C /3hrs Heavy metals 10ppm Max Complies Atomic Absorption Pb 2ppm Max 1.28ppm Atomic Absorption Cd 1ppm Max 0.1ppm Atomic Absorption Hg 0.1ppm Max 0.01ppm Max Atomic Absorption Microbiology Total plate count 10000cfu/g Max Complies AOAC Yeast & Mold 1000cfu/g Max Complies AOAC E. Coli Negative Negative AOAC Salmonella Negative Negative AOAC Function: 1. It is a kind of spectrum antibiotic,inhibit most gram-positive bacteria. 2. Usnic Acid also has inhibition function to the trichomonas vaginalis. 3. It has a certain curative effect to cure cervical inflammation,perineal rupture, dysentery and skin disease. 4. It is used as an antibacteria agent in cosmetics and ointments to prevent skin infection. It is also used in formulating deodorant, mouth-care products. Usnic Acid Pure Plant Extracts , 98% Usnea Lichen Extract Cosmetic Raw Materials 1 Application: 1. Pharmaceuticals Usage : Usnic Acid has a selective inhibitory effect on streptococcus, the main bacterium causing oral diseases and dental caries. Usnic Acid is effective for various skin diseases such as burns, infections, and psoriasis. It can improve the symptoms of tuberculosis and intestinal tuberculosis, and even make the microscopic examination of tuberculosis bacteria negative. Used for purulent wounds, burns and skin infections. It has analgesic and antipyretic effects. Usnic Acid has similar effects to antiviral drugs, antiprotozoal drugs,antiproliferative active drugs and anti-inflammatory drugs. Usnic Acid can be used as a preservative. 2. Cosmetics usage: Usnic Acid is a broad-spectrum antibiotic, used as a highly effective preservative in cosmetics. Contact:
Phone: Fax: Email: Xi'an Spring Biotechnology Co., Ltd.
Room 1508, Digital Building, No. 8 Keji 5th Road, Yanta District, Xi'an City, Shaanxi Province Xian 710000 China 1/19/22 3:31 GMT
High Light Transmittance LED White Light Diffusing Powder For Polycarbonate
LED White Light Diffusing Powder With High Light Transmittance For Polytech Masterbatch / Polycarbonate Product Description KS-200 is a silicone plymer resin powder and a kind of effivient LED/LCD light diffusion agent. It's mainly applied to PC, PVC, PMMA ,Color Masterbatch and functional Masterbatch, PET transparent resin and LED. It is effective to increase of light scattering and transmission and emit soft and beautiful light which build a light and comfortable effect. High Light Transmittance LED White Light Diffusing Powder For Polycarbonate 0 Feature 1. Temperature resistance above 300℃, aging resistance, no yellowing, no black spots; 2. High light transmittance, energy saving; less addition and low cost; 3. Narrow particle size distribution and stable optical index; 4. High haze makes the dazzling incident light turn into unobtrusive soft light; 5. Low light loss and high light diffusion efficiency can fully meet the requirements of higher brightness and energy saving of LED lighting, packaging, light diffusion film, etc; 6. In transparent materials such as PC, pet, PMMA, PS and PVC, 0.5-1% of the additive amount can reach more than 86% of the light transmittance and more than 90% of the haze. Application PC,PMMA,PS,ABS and PVC lampshade,light diffusion plate, LED light emitting resin, electronic display board, digital tube lattice, luminous word, cosmetic bottle and color masterbatch or functional masterbatch How to use This product has good dispersion in the resin and directly added into pellets; the dispersion uniformity is better if coating silica bead and precoating liquid. Contact:
Phone: Fax: Email: Guangzhou Batai Chemical Co., Ltd.
Room 1101, Building A2, Xinggang International, Country Garden, Xinhua Town, Huadu District, Guangzh Guangzhou 510800 China 1/14/22 7:04 GMT
C10H14O5 AAEMA Monomer Reduced Resin Viscosity Methacrylic Monomer
AAEMA Monomer Methacrylic Monomer Reduced Resin Viscosity Product Description AAEM readily polymerizes with other acrylic and methacrylic monomers. It is a methacrylic monomer used to formulate high-solids solution acrylic resins and acrylic emulsions for lower VOC emission industrial and architectural coatings. Chemical name Concentration Additional identification 2-(acetoacetoxy)ethyl methacrylate >95% CAS-No.: 21282-97-3 EC No.: 244-311-1 2-hydroxyethyl methacrylate <5% CAS-No.: 868-77-9 EC No.: 212-782-2 INDEX No.: 607-124-00-X The ability of AAEM to react with amines and hydrazides makes it an ideal monomer for self-crosslinkable, room temperature cure acrylic emulsions. It also finds use in acetoacetylated polymers crosslinked through chelation with metal ions and for acetoacetylated polymers for producing colorfast fibers. Product Features — Improved adhesion to metal substrates — Low glass transition temperature for improved coating flexibility — Outstanding flexibility and corrosion resistance — Reaction with conventional crosslinkers — Resin viscosity reduction for lower VOC emissions — Room temperature cure, isocyanate-free crosslinking Product Key Applications — Acetoacetylated polymers — Adhesive polymers — Cosmetic polymer intermediate — Pharmaceutical intermediate — Reactive monomer for UV cure applications — Self-crosslinkable acrylic emulsions Contact:
Phone: Fax: Email: ShenZhen Prechem New Materials Co.,Ltd
Room 3108, Block A, Electronic Technology Building, No. 2070, Shennan Middle Road, Shenzhen, China Shenzhen 518000 China 12/29/21 6:48 GMT
solid abrasives
We're supply D-36 The finishing abrasive, It's a solid square abrasive in blue, It's used for gold, silver, platinum, and white gold. Especially white precious metals such as white gold. It is excellent for the side gloss of the frames of glasses. thod of use Rotate the buff attached to the motor or handpiece to apply the light medicine and use it. We are Supply and sale regardless of quantity from small to large. In addition to D-36, we also deal with S&TY-402N(Old name:D-24), S&TY-404N(N-5000) Minimum Order: 10 long tons Contact:
Phone: Fax: Email: senforce
http://www.senforcetrading.com/bbs/board.php?bo_table=s2_1&sca=Surface%20Treatment yongin 16954 Korea (South) 12/27/21 8:07 GMT
2000C First Rate Saturated Polyester Resins Excellent Mechanical Property
First-rate Economical Polyester Resin NH9306 with Excellent Mechanical Property and Weathering Resistance ◇ Applications: NH-9306 is a carboxyl polyester resin designed for 93/7 polyester/TGIC powder coatings to be cured at 200℃. ◇ Basic features: Excellent weathering resistance Good storage stability Improved mechanical properties compared with NH9307 ◇ Specifications: Appearance: light yellow or white transparent flakes Color(50%DMF) max:3 Acid number(mgKOH/g): 30-36 Softening point(℃): 101~113 Glass transition temp.( ℃): ~62 Melting viscosity(mPa.s200℃): 5000±1500 Reactivity at 180℃(s, 7% TGIC): 180±60 ◇ Recommend Formulation:NH9306—TGIC NH-9306 TGIC Filler & pigment Leveling agent Benzoin 200 15 140 2.4 1.2 ◇ Extrusion Condition: Two-screw extruder Zone I: 90~110℃ Zone II: 110~120℃ Speed of revolution: 500-1200 rpm Fineness of powder: <100μm ◇ Application Condition: Electrostatic spraying with: 40~70KV Degreased cold-rolled steel: 0.5mm Film thickness: 50~70μm ◇ Curing Requirement: 200℃×15 min ◇ Film Properties: Gel time (180℃, s): 200-350 Flow(180℃,mm): 24~28 Gloss(60°): ≥85% Adhesive(1mm,grade): 0 Pencil hardness: ≥1H Bending (φ1mm): Pass Impact: pass 50 kg·cm ◇ Packaging: PE bags, N.W. 25KG±0.1KG / bag Contact:
Phone: Fax: Email: Kinte Materials Science and Technology Co.,Ltd
16th Yufeng Road, HuaDu District , Guangzhou,China Guangzhou 510000 China 12/13/21 8:31 GMT
Sodium Dichloroisocyanurate
Sodium dichloroisocyanurate disinfectant, sodium dichloroisocyanurate sdic is a kind of disinfectant. The product has high efficiency and constant performance and has no harm to human beings. It enjoys a good reputation both at home and abroad. SDIC China , as a new high-efficiency special disinfectant for swimming pool and sauna water treatment, can quickly kill intestinal pathogenic bacteria, pyogenic coccus, pathogenic yeast, and inactivate viruses. The effect is stable and long-lasting. HS-CODE: 2933 6929 10 Un No.: 2465 Molecular weight: 219.65 Formula: C3O3N3Cl2Na CAS No.: 2893-78-9 Specification of Sodium Dichloroisocyanurate Feature and Advantage of Sodium Dichloroisocyanurate Strong sterilization. Safe and convenient to use. Wide sterilization range Strong disinfection ability. Non-toxic and harmless. Application of Sodium Dichloroisocyanurate 1. This product can be used in swimming pools, drinking water, industrial circulating-cooling water treatment. 2. It can be used in the disinfection of tableware, sterilization of houses, hotels, hospitals, and public places. It can also be used in environment disinfection of feeding fish, silkworm, livestock, and poultry. 3. Sterilization: Disinfecting in hospital, family, hotel, public place, pharmaceuticals, breeding industry. 4. Moreover, it can be used in shrinkage resistance and weaving of wool, bleaching of textile, and chlorination of rubber. Cautions of Sodium Dichloroisocyanurate 1. Contact with combustible material may cause a fire. 2. SDIC is corrosive, with an irritating smell, and burns to eyes, eye film, skin, etc. contact with the human body is strictly prohibited. In case of accidental contact, it should be washed with water in time, and sent to the hospital for treatment in case of serious contact. 3. Operators should wear protective glasses, rubber gloves, and other labor protection articles. As a sodium dichloroisocyanurate factory, sodium dichloroisocyanurate manufacturer, Rosun has always been adhering to the core development concept of science, quality, health, and environmental protection, adhering to the sacred mission of "Makes The Rivers And Earth Cleaner, Helps Billions Of People Be Healthier.", serving the society, serving the cause of human environmental protection and health! If you want to know more information about our disinfectant factory, please visit our website. Minimum Order: 1 bags Contact:
Phone: Fax: Email: Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China Sichuan 610100 China SOURCE: Import-Export Bulletin Board (https://www.imexbb.com/)
© 1996-2025 IMEXBB.com. All rights reserved.
|
|
||||||||||||||||||||||||||||||||||