Chemicals & Plastics

Perfect endodontic files This product is composed of three parts: h and k files tip (working part), indicator sheet and handle. Among them: the tip is made of stainless steel or nickel-titanium memory alloy; Indicator is made of silicone rubber; The handle is made of PBT plastic. Rotary Super Gold Files ApplicationDental AreaFunctionEndo TreatmentProduct detailMade of high quality niti alloy,after heat activation treatment becomes golden colorGood flexibility, high quality cutting efficiency. Rotary V-blue Flies The files color endo body adopts unique mirroredS-shaped cross sectionRECIPROC blue is packed sterile and independentOpen for instant use, provide continuousand efficient cutting, and prevent cross infection. Rotary V-flies Length Follow polycrystal NITI Alloy material CNC programClassic silver, gold and blue activationS-shape cross section. Stainless Steel Barbed Broaches (Engine) Used to pull out the endodontium in the root canal treatment. Stainless Steel Barbed Broaches(Hand) Product DetailsWith plastic handle, used for the pulp extirpation therapy of the molar teeth.Made of high medical stainless steel material. Stainless Steel H,K,R Files (Engine) The handle is made of nylon (PA) injection molding; The file rod is made of nickel-titanium alloy or stainless steel.UsageFor clinical dental root canal treatment. Stainless Steel Plugger, Spreader Files (Hand) Made of medical stainless steel or nickel-titanium alloy, used for filling the working part of root canal filling.Implement ISO 0.2 taper international standard, complete model 15-80# to choose from. Stainless Steel K-FLEXOFILE (Hand) This product is composed of three parts: file tip (working part), indicator sheet and handle. Among them: the tip is made of stainless steel or nickel- titanium memory alloy. Stainless Steel H,K,R Files (Hand) MaterialStainless steelLength21mm 25mm 28mm 31mm NiTi Rotary Supper Files (V+-Files) Varitaper(Gold heat activation)Made of high quality niti alloyHigh quality cutting efficiency and fracture resistanceRecommended rotary speed of engine files is 150～350r/min6pcs per pack, available for single for assorted sizes. Deatils of reciprocating files in endodontics Indication: The product is for clinical root canal treatment (manual operation). Storage and transportation conditions: Temperature: 0 ℃ to 40℃ Humidity: 0-93%RH Atmospheric pressure: 76-106kPa Product Maintenance And Maintenance Methods: Immediately after use, soak all appliances in a detergent and disinfecting solution, combined with proteolytic enzymes if conditions permit, to prevent crumbs from filing, use a soft-bristled toothbrush when cleaning. Follow the instructions in the sterilization manual below: The packaging of the file should be removed before sterilization. It should be noted that the file may be slightly bent during packaging due to its special material characteristics, but can be corrected manually. Place the instrument in a file base, bracket, or container to avoid contact with other instruments If the disinfectant solution contains etchant, it is recommended. to wash the appliance before high pressure steam curing Place the toolbox in a sterilizing bag. The prions were sterilized by steam for 6 minutes at 134℃, and the drying time was 20 minutes Put the device in a sterilized package and place it in a dry and clean environment. UMG Advantages of Dental File More than 9years of experience in medical equipment marketing With a full range of products, we are sure that you will find what you need Leading medical equipment industry, we can provide you with the most advanced products Cooperated widely with other enterprises in medical equipment industry over the years, we have accumulated a lot of experience; we will provide more professional and thoughtful service to satisfy the needs of customers. Providing comparative price and high quality products, so far, our company have cooperated with many customers from over 50 countries and gained good reputation at home and abroad What Are Endodontic File Colors? As for the endodontic file colors, normally the standard size 50 is yellow, size 55 is red and size 60 is blue. As what is mentioned above, from standard size 15 to standard size 60, the standard incremental increase in working diameter is 0.05 mm. If you want to know more about teeth supplies, please visit our website. We offer dental instruments for sale, if you have needs, contact us.

As a professional peptide company in China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, from ug to g with 70% to 99% purity, can also be made according to your requirements. Modified histones can be applied to nucleosome assembly and the subsequent study of biochemical function and structure. Histones are proteins that condense and package DNA neatly into chromosomes. Different types of histone modifications affect different processes in the cell such as the activation/ inactivation of transcription, chromosome packaging, DNA damage and DNA repair. The histone modifications is an important post- translational process that plays a key role in gene expression. Histone modifications impact gene expression by changing the structure of chromatin or through the recruitment of histone modifiers. Histones pack DNA into structures called nucleosomes, to fit the DNA molecule into the nucleus. Each of these nucleosomes has two subunits, each comprising the core histone H2A protein, histone H2B protein, histone H3 protein and histone H4 peptide, and a linker histone called H1 that acts as a stabilizer. If you want to know the process of peptide manufacturing, please contact us.

ASIC1 channels, Mambalgin 1 is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. 1609937-15-6 Product Name Mambalgin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 6554.5 Da Molecular formula C272H429N85O84S10 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETEN , NKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) APPLICATION OF MAMBALGIN 1 Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells. As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us. More information about our pre clinical trial, please visit our website.

L Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs in high concentrations in muscle and brain tissue. SPECIFICATION OF L CARNOSINE Purity(HPLC) ≥98% Content ≥99% 20% below market price 1000+kg per month Fast delivery APPLICATION OF L CARNOSINE Product Name L-Carnosine β-Alanyl-L-histidine H-β-Ala-His-OH CAS-No. 305-84-0 Molecular Formula C9H14N4O3 Sequence β-Ala-His Molecular Weight 226.232g/mol Package 1kg, 25kg, customizable Appearance White powder Application Cosmetic raw materials Storage 2～8℃ Efficacy and Mechanism of Action: Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water- borne antioxidant with wound healing activity and naturally occurs in high concentrations in muscle and brain tissue. Carnosine is an unsaturated aldehyde that scavenges reactive oxygen species and peroxidizes fatty acids in cell membranes during oxidative stress. Low molecular weight water-soluble unmodified dipeptide-Ala-His has very little affinity for skin and does not penetrate beyond the first layer of cuticle. However, the lipophilic peptide palmitoyl-Ala-His diffused into the cuticle, epidermis, and dermis, and no systemic activity was observed. If you want to know more about l carnosine price, please contact us. As a peptide supplier, we will produce more high quality products for customers, if you have needs, please contact us. More information about our chemical structure identification, please visit our website.

SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. 820959-57-7 Product Name kurtoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 7386.36 Molecular formula C324H478N94O90S8 Source Peptides Synthesis Storage Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence KIDGYPVDYW NCKRICWYNN KYCNDLCKGL KADSGYCWGW TLSCYCQGLP DNARIKRSGR CRA (Modifications: Disulfide bonds: 12-61, 16-37, 23-44, 27-46) APPLICATION OF KKURTOXIN Kurtoxin, a 63-amino acid peptide stabilized by four disulfide bonds, is the first reported peptide inhibitor of T-type voltage-gated calcium channels If you want to know more about peptide polypeptide, please contact us.

The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels. SPECIFICATION OF KALIOTOXIN CAT K1070-V CAS NO. 145199-73-1 Product Name Kaliotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4149.89 Da Molecular formula C171H283N55O49S6 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) APPLICATION OF KALIOTOXIN Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system. As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about peptide library, please visit our website.

CAT K1060-V CAS NO. 129203-60-7 Product Name Iberiotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4230.9 Da Molecular formula C179H276N50O56S7 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) APPLICATION OF IBERIOTOXIN Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel. As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about synthetic route, please visit our website.

Furniture UV Coating Production Line The UV wood coating machine coats the rolled substrate with a layer of glue, paint or ink with a specific function, and then winds it after drying. UV coating line for sale uses a dedicated high-speed coating head, which can effectively reduce the generation of bubbles. The rewinding and unwinding of the industrial coating machine are equipped with a full-speed automatic film splicing mechanism, and the tension is automatically controlled by a closed loop. Specification of UV Coating Machine Place of Origin Jiangsu, China ChinBrand Name KISINHOM Condition New Machine Type other woodworking machines Warranty 1 Year Certification CE ISO9001 Application Plywood, solid wood, particleboard After Warranty Service Video technical support, Online support, Spare parts, Field maintenance, and repair service The Advantage of the Furniture UV Coater Machine The industrial coating machine is equipped with micro-gravure coating technology, precision scraper, automatic gap adjustment, five-roll coating, zero-speed rewinding and unwinding, and other necessary technologies for the production of high-quality products. UV coating machine for sale also adopts original imported accessories and learn the technical advantages of similar machinery around the world. Continuously innovate coating technologies such as coating, drying, unwinding, and coiling, and independent research and develop new units to improve manufacturing quality. UV Coater Machine Applied in Wood Furniture As a professional coating machine manufacturer, our UV coating machine for sale is widely used in wooden furniture. Our machine is a full-precision two-roll coater, which is precisely operated. The products manufactured by our high- quality coating machine have high-quality materials, fine workmanship and reliable quality. In addition, the high efficiency of the UV coater for sale greatly improves the production efficiency; the stable structure ensures the safe and stable production process; the long life of the industrial coating machine saves customers' use costs; we provide the best after-sales service and will sincerely solve the problem for you. As one of the PVC coating machine manufacturers china, Suzhou Kisinhom Machinery Co., Ltd. was established on April 10, 2018 and is located at No. 168, Nanyuan Road, Dianshanhu Town, Kunshan City, Jiangsu Province.

Minimum Order: 1 bags

Application Tips To obtain a smooth and neat finish, apply masking tape and remove before sealant cres. Paint surfaces completely before applying sealant. Before processing, observe the instructions in our product leaflets and safety data sheets. Product Description GP Acetic cure Silicone Sealant is a one-part, acid and moisture cure, medium modulus silicone sealant that provides durable, pliable, watertight joints and offers outstanding adhesion without priming to most non-porous substrates. Material preparation: For successful bonding, glass must be clean of all dust, dirt and oil. The cleaned glass should be wiped dry immediately with a clean, lint free cloth or blown dry with hot oil free air. DO NOT clean glass with soap and water solutions. Soap residue can cat as a release agent and result in adhesion failure. Clean glass should be handled with clean, lint free gloves or equivalent only. Oils from hands and fingers can act a release agents resulting in adhesion failure.

Tips: There are four main characteristics of the pharmaceutical cold chain: 1. Security In the evaluation of pharmaceutical cold chain transportation services, safety is at the forefront, which is determined by the particularity of logistics objects. 2. Sudden demand Due to the sudden outbreak of too many diseases, which are easily contagious and spread rapidly, the demand for refrigerated medicines is of a sudden nature, which requires high emergency service capabilities of logistics providers. 3. High cost Compared with the cost of ordinary transportation, the cost of cold chain transportation is generally about 80% higher 4. Professionalism The transportation and storage of medicines must be operated within a specific temperature range in accordance with national regulations, and in-transit GPS management must be implemented to achieve traceability of refrigerated medicines. Introduction to use: Cold compress: put it in freezer or freezer (-10℃ -- 20℃) for more than 30 minutes before use. Hot compress: wrap the cold and hot bag with a slightly wet towel, put it into the microwave oven and turn it to medium heat. Heat it for the first time within 60-100 seconds, and feel whether the temperature is appropriate after taking it out. If it is not hot enough, continue heating every 10-20 seconds until it is warm enough. If continuous use, subsequent heating time control in 50-60 seconds (medium heat). Hot water: Soak hot and cold bags in boiling water for about 4 minutes, or reheat for another 1 minute if the temperature is not enough.

Large and Practical Design – The sides of each storage utility crate with easy-grip armrests, provides 30 liters of space for all kinds of personal items. Lidded design Storage Bins,safe storage, waterproof and dustproof. Multipurpose Storage Crate – Our plastic storage boxes are ideal for organizing closet space, keeping your vehicle trunk neatly arranged, or storing clothes, toy, books,snack, shoe, and grocery. Premium Collapsible Storage Box – Made of quality PP materials,this utility box is long-lasting durability, strength, lightweight and sturdy.Environmentally friendly. Stackable Tote Storage Container - Several storage boxes can be stacked on top of each other. It can be stacked in multiple layers to save space and increase stability. With good load capacity, you can organize and transport your necessary items more easily. Space-Saving, Foldable Design – These stackable folding collapsible storage bins can collapse completely flat to make them easier to store when not being used.It is also ideal for transporting objects on a trip.

Best alprazolam powder suppliers . All our products are 100% high quality, pure and genuine. Shipping is 100% safe, fast and reliable worldwide. buy alprazolam online, alprazolam for sale, bu alprazolam online Wickr: cnbilly Skype :chunhuachems WhatsApp: +1 (240) 507‑5639 Email: chunhuachems@gmail.com Website : https://leo-rchemical.com/product/buy-alprazolam/< , br> alprazolam powder for sale china alprazolam powder for sale online pure alprazolam powder for sale alprazolam powder for sale alprazolam powder for sale usa alprazolam powder for sale classifieds alprazolam powder for sale classifieds free classifieds alprazolam powder for sale alprazolam powder suppliers buy alprazolam powder online alprazolam powder wholesale alprazolam raw powder alprazolam powder alprazolam powder for sale online alprazolam powder price ephedrine powder china how to make alprazolam powder Delivery Time: within 2-5 days Port: Shenzhen, Poland ,Hongkong Purity: 99% Package: Standard export package Payment: BITCOIN,WESTERN UNION, T/T, MONEY GRAM Shipment: by sea or express (TNT, UPS, DHL, FEDEX, EMS) and Client's request Welcome to send your inquires to us ,we will quote you very competitive price with high quality .

Minimum Order: 10 long tons

Product Description: Wholesale Custom Clear IML Chicken Feed Square Plastic Bucket with Lid Capacity 5L Color Black or other Dimensions 25*17*15.8cm (L*W*H) Material PP or PE Decoration Screen printing,Heat transferprinting,IML Usage Food,Powder,Paint,liquid Service: After sending, we will track the components for you once every two days, until you get it. When you got the tin components, test them, and give me a feedback. If you have any questions about the problem, contact with us, we will offer the solve way for you.

16-1600mm High speed HDPE pipe Extrusion line Introduction HDPE Pipe Extrusion Machine is widely used in the whole country water supply, water sewage, gas supply and house water supply project. It includes HDPE Plastic pipe extrusion machine, LDPE Plastic pipe extrusion machines, PPR/PERT Pipe extrusion lines, ect. YILI machinery adopts European most advance technology and develops with its own technical Strategy to ensure unique structure, high configuration, highly automation, easy operation of the whole pipe extrusion machine. The whole line adopts PLC control system and large liquid crystal screen, which makes the operation very convenient. The line can be equipped with another extruder used for extruding the mark line.