Import-Export Bulletin Board Post an Offer to Sell

New here? Please subscribe
to post trade leads. It's FREE!

Other Chemicals


Home > Offers to Sell > Chemicals & Plastics > Other Chemicals > Other Chemicals

Browse leads by category:
    
    Other Chemicals
 
 

Summary of 8/13/26 20:12 GMT:>> Show Compact View
3/10/22 7:33 GMT
Sn42Bi58 Pure Tin Low Temp Lead Free Solder Bar Tin Bismuth Environmentally

Environmentally friendly lead-free low temperature tin bar Tin-bismuth solder bar This product is a high-temperature-resistant solder bar with high purity, oxides, less dross, no film chips, no sections, bright, fast soldering, good wettability, and fast soldering. Suitable for tin on the feet of high temperature resistant components. 1.Features: 1. Fast melting speed 2. Good wettability 3. Good continuous weldability 4. Good diffusion 5. High economy 2.Scope of application: 5G base station peripheral materials Automobile industry New energy industry Computer peripheral industry Communication industry Audio industry 3.Product parameter: Brand TUOPU product name Lead-free low temperature solder bar Appearance bright, light yellow Material Sn/Bi Melting point 138±2℃ Length 338mm Shape strip, rod Single weight about 0.7kg Packing specification 20kg/box model Sn42Bi58 Packing Carton custom made According to customer process requirements

Contact:
Phone:
Fax:
Email:
Mr. Zhang
86-510-83796382
86-510-83793793
Send Inquiry
Wuxi Tuopu Chemical Co., Ltd.
No. 280, Xigang East Road, Xibei Town, Xishan District, Wuxi City
Wuxi 214000
China
3/10/22 2:01 GMT
Hydroxypropyl Methyl Cellulose HPMC Chemical 200000 Viscosity For Detergent

1. Construction: As the water-retaining agent and retarder for cement mortar, HPMC make the mortar have pumping ability. Use mortar, gypsum,putty powder , or other building materials as adhesive to improve drawing models and extend operable time. Use as adhesive tile, marble, plastic decoration, and adhesive reinforcement, also can reduce the amount of cement. The water retention of HPMC ensures that the slurry will not crack due to drying too quickly after application, thus enhancing the strength after hardening. 2. Coating: As a thickening agent, dispersant and stabilizer in the coating industry, it has good solubility in water or organic solvent. 3. Ceramic manufacture: Widely used as an adhesion in the manufacture of ceramic products. 4. Detergent: Our HPMC products are also suitable for the productin of laundry powder and the thickening of daily chemical products such as laundry liquid and shampoo. 5. Other: Can also be used in ink printing, PVC, leather, paper products and other industries.

Contact:
Phone:
Fax:
Email:
Lily
86-139-30417802
86-311-84455168
Send Inquiry
Jinzhou City Yuming Trading Co., Ltd.
JINZHOU CITY, HEBEI PROVINCE, CHINA
JINZHOU 052200
China
3/9/22 9:16 GMT
Impreganted Paper Anti Blocking Additive Agent Durable ISO9001

Brand name FENTENG Classification Chemical Auxiliary Agent Other Names Impregnated paper additives Place of Origin Guangdong ,China Usage Paper Chemicals, Surfactants Application For Impregnated paper making Appearance light yellow transparent liquid Product name Dispersant Additive Type Surfactant Mixture Model Number RP201 Shelf Life 1 YEAR MOQ 1Ton (simple is free) Packaging Details 1000kgs per IBC drumor 200kgs per plastic drum if you want to know more about the product ,please contact with us ,we will reply to you in 24 hours. PRODUCT INTRODUCTION FENTENG AS200 is an anti-stick agent for impregnated paper, which can effectively prevent the adhesion of urea-formaldehyde resin and melamine formaldehyde resin impregnated paper. It can effectively prevent urea- formaldehyde resin from penetrating into the surface of melamine resin.

Contact:
Phone:
Fax:
Email:
Mrs. Ada
86-0757-87278170
86-0757-87278170
Send Inquiry
Fenteng Fine Chem Tech(Foshan) Co.,Ltd
F4 3-1 Kaiyuan Road,Datang Industrial Park, Sanshui District, Foshan City,Guangdong Province,China
Foshan 528000
China
3/7/22 9:16 GMT
Reactive Dyes Textile Auxiliary Agent For Cotton Linen Viscose Ph7

Intensifier deep agent-- Physical properties: Appearance milk white liquid PH value(1%water liquor) 4 - 7 Specific gravity (20℃) 0.98g±0.05 Solubility easy disslove cold water       Application and character : The product fit for all kinds of synthetic fibre and natural fibre dipping ,gaddin gartifactitious.It could endue fabric excellent adden deepless,adden colourful and adden shiny effect ,but couldn`t infection fabric color fasten and shine fasten. Use ways: 1.Dose Commonly dose is 10-50g/L.About the detail dose,the factory should according as oneself fact (as color dark, dyestuff concerntration ),adjust dose by sample. 2.Technical flow dyeing→washing → darken (gadding )→drying→other finishing 3.Attention   ① After dyeing,should washing with enough water ,for fear remainder agent infection effect .   ② Adden deepless process,should try best control the same with every time ,for fear making color difference.   ③ Adder dose,bigger add deepless,darken process should first after dyeing ,couldn't compound use with other finishing.   ④ We could proper add the time of dipping if fabric thicker (or adden a litter special filter agent ),adden deepless effect shall better.

Contact:
Phone:
Fax:
Email:
Mr. shaw
86-139-12376797
86-139-12376797
Send Inquiry
INTRACHEM CO.,LTD
Wuyun Road, huishan, wuxi, jiangsu province, China
Wuxi 214000
China
3/4/22 8:08 GMT
100 Tests CFDNA Extraction Kit For Next Generation Sequencing

High quality nucleic acid is the guarantee for genomics research. BunnyTeeth Technology uses superparamagnetic bead purification technology to provide users with a highly sensitive nucleic acid extraction solution that easily achieves trace nucleic acid extraction for low concentration. As verified by thousands of clinical samples, BunnyMag cfDNA Extration Kit for Next Generation Sequencing 25/50/100 tests can extract high quality cfDNA from cell-free body fluids such as fresh or frozen plasma, serum, pleural fluid, ascites and cerebrospinal fluid for scientific research and clinical in-vitro diagnostic use. Packing Content Main components Lysis Binding Buffer Guanidine isothiocyanate, 5 M Washing Buffer 1 Guanidine isothiocyanate, 3 M Washing Buffer 2 Ethanol absolute, 80% Proteinase K 20 mg/mL Proteinase K Magnetic Beads Nano-magnetic beads

Contact:
Phone:
Fax:
Email:
Mr. zhu
86-152-95035903
86-152-95035903
Send Inquiry
BunnyTeeth Technology Inc.
Unit A, Zhongdan Bioscience Industrial Park, Jiangbei New District, Nanjing, Jiangsu, China
Nanjing 210000
China
3/3/22 3:21 GMT
MODIFIED HISTONE

As a professional peptide company in China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, from ug to g with 70% to 99% purity, can also be made according to your requirements. Modified histones can be applied to nucleosome assembly and the subsequent study of biochemical function and structure. Histones are proteins that condense and package DNA neatly into chromosomes. Different types of histone modifications affect different processes in the cell such as the activation/ inactivation of transcription, chromosome packaging, DNA damage and DNA repair. The histone modifications is an important post- translational process that plays a key role in gene expression. Histone modifications impact gene expression by changing the structure of chromatin or through the recruitment of histone modifiers. Histones pack DNA into structures called nucleosomes, to fit the DNA molecule into the nucleus. Each of these nucleosomes has two subunits, each comprising the core histone H2A protein, histone H2B protein, histone H3 protein and histone H4 peptide, and a linker histone called H1 that acts as a stabilizer. If you want to know the process of peptide manufacturing, please contact us.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:16 GMT
MAMBALGIN 1

ASIC1 channels, Mambalgin 1 is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. 1609937-15-6 Product Name Mambalgin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 6554.5 Da Molecular formula C272H429N85O84S10 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETEN , NKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) APPLICATION OF MAMBALGIN 1 Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells. As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us. More information about our pre clinical trial, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:14 GMT
L CARNOSINE

L Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs in high concentrations in muscle and brain tissue. SPECIFICATION OF L CARNOSINE Purity(HPLC) ≥98% Content ≥99% 20% below market price 1000+kg per month Fast delivery APPLICATION OF L CARNOSINE Product Name L-Carnosine β-Alanyl-L-histidine H-β-Ala-His-OH CAS-No. 305-84-0 Molecular Formula C9H14N4O3 Sequence β-Ala-His Molecular Weight 226.232g/mol Package 1kg, 25kg, customizable Appearance White powder Application Cosmetic raw materials Storage 2~8℃ Efficacy and Mechanism of Action: Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water- borne antioxidant with wound healing activity and naturally occurs in high concentrations in muscle and brain tissue. Carnosine is an unsaturated aldehyde that scavenges reactive oxygen species and peroxidizes fatty acids in cell membranes during oxidative stress. Low molecular weight water-soluble unmodified dipeptide-Ala-His has very little affinity for skin and does not penetrate beyond the first layer of cuticle. However, the lipophilic peptide palmitoyl-Ala-His diffused into the cuticle, epidermis, and dermis, and no systemic activity was observed. If you want to know more about l carnosine price, please contact us. As a peptide supplier, we will produce more high quality products for customers, if you have needs, please contact us. More information about our chemical structure identification, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:13 GMT
KURTOXIN

SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. 820959-57-7 Product Name kurtoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 7386.36 Molecular formula C324H478N94O90S8 Source Peptides Synthesis Storage Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence KIDGYPVDYW NCKRICWYNN KYCNDLCKGL KADSGYCWGW TLSCYCQGLP DNARIKRSGR CRA (Modifications: Disulfide bonds: 12-61, 16-37, 23-44, 27-46) APPLICATION OF KKURTOXIN Kurtoxin, a 63-amino acid peptide stabilized by four disulfide bonds, is the first reported peptide inhibitor of T-type voltage-gated calcium channels If you want to know more about peptide polypeptide, please contact us.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:12 GMT
KALIOTOXIN

The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels. SPECIFICATION OF KALIOTOXIN CAT K1070-V CAS NO. 145199-73-1 Product Name Kaliotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4149.89 Da Molecular formula C171H283N55O49S6 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) APPLICATION OF KALIOTOXIN Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system. As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about peptide library, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:09 GMT
SPECIFICATION OF IBERIOTOXIN

CAT K1060-V CAS NO. 129203-60-7 Product Name Iberiotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4230.9 Da Molecular formula C179H276N50O56S7 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) APPLICATION OF IBERIOTOXIN Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel. As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about synthetic route, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/2/22 3:54 GMT
750g Sausage Construction Silicone Sealant Glue RTV Epoxy Resin Structural

Application Tips To obtain a smooth and neat finish, apply masking tape and remove before sealant cres. Paint surfaces completely before applying sealant. Before processing, observe the instructions in our product leaflets and safety data sheets. Product Description GP Acetic cure Silicone Sealant is a one-part, acid and moisture cure, medium modulus silicone sealant that provides durable, pliable, watertight joints and offers outstanding adhesion without priming to most non-porous substrates. Material preparation: For successful bonding, glass must be clean of all dust, dirt and oil. The cleaned glass should be wiped dry immediately with a clean, lint free cloth or blown dry with hot oil free air. DO NOT clean glass with soap and water solutions. Soap residue can cat as a release agent and result in adhesion failure. Clean glass should be handled with clean, lint free gloves or equivalent only. Oils from hands and fingers can act a release agents resulting in adhesion failure.

Contact:
Phone:
Fax:
Email:
Miss. Wang
86-536-15628715885
86-536-15628715885
Send Inquiry
linqu yuanyang adhesive industry co.,ltd.
Donghuan Road, Linqu County, Weifang City, Shandong Province
Weifang 261000
China
3/2/22 2:50 GMT
400g Medical Treatment For Pain Relief Reusable Ice Packs

Tips: There are four main characteristics of the pharmaceutical cold chain: 1. Security In the evaluation of pharmaceutical cold chain transportation services, safety is at the forefront, which is determined by the particularity of logistics objects. 2. Sudden demand Due to the sudden outbreak of too many diseases, which are easily contagious and spread rapidly, the demand for refrigerated medicines is of a sudden nature, which requires high emergency service capabilities of logistics providers. 3. High cost Compared with the cost of ordinary transportation, the cost of cold chain transportation is generally about 80% higher 4. Professionalism The transportation and storage of medicines must be operated within a specific temperature range in accordance with national regulations, and in-transit GPS management must be implemented to achieve traceability of refrigerated medicines. Introduction to use: Cold compress: put it in freezer or freezer (-10℃ -- 20℃) for more than 30 minutes before use. Hot compress: wrap the cold and hot bag with a slightly wet towel, put it into the microwave oven and turn it to medium heat. Heat it for the first time within 60-100 seconds, and feel whether the temperature is appropriate after taking it out. If it is not hot enough, continue heating every 10-20 seconds until it is warm enough. If continuous use, subsequent heating time control in 50-60 seconds (medium heat). Hot water: Soak hot and cold bags in boiling water for about 4 minutes, or reheat for another 1 minute if the temperature is not enough.

Contact:
Phone:
Fax:
Email:
Miss. Liu
86-156-82115428
86-156-82115428
Send Inquiry
Sichuan Aishipaier New Material Technology Co., Ltd.
Room 2010, 20th Floor, IMP Global Metropolis Plaza, No. 318, Dongda Road, Jinjiang District, Chengdu, Sichuan, China
Chengdu 610000
China
1/19/22 3:31 GMT
High Light Transmittance LED White Light Diffusing Powder For Polycarbonate

LED White Light Diffusing Powder With High Light Transmittance For Polytech Masterbatch / Polycarbonate Product Description KS-200 is a silicone plymer resin powder and a kind of effivient LED/LCD light diffusion agent. It's mainly applied to PC, PVC, PMMA ,Color Masterbatch and functional Masterbatch, PET transparent resin and LED. It is effective to increase of light scattering and transmission and emit soft and beautiful light which build a light and comfortable effect. High Light Transmittance LED White Light Diffusing Powder For Polycarbonate 0 Feature 1. Temperature resistance above 300℃, aging resistance, no yellowing, no black spots; 2. High light transmittance, energy saving; less addition and low cost; 3. Narrow particle size distribution and stable optical index; 4. High haze makes the dazzling incident light turn into unobtrusive soft light; 5. Low light loss and high light diffusion efficiency can fully meet the requirements of higher brightness and energy saving of LED lighting, packaging, light diffusion film, etc; 6. In transparent materials such as PC, pet, PMMA, PS and PVC, 0.5-1% of the additive amount can reach more than 86% of the light transmittance and more than 90% of the haze. Application PC,PMMA,PS,ABS and PVC lampshade,light diffusion plate, LED light emitting resin, electronic display board, digital tube lattice, luminous word, cosmetic bottle and color masterbatch or functional masterbatch How to use This product has good dispersion in the resin and directly added into pellets; the dispersion uniformity is better if coating silica bead and precoating liquid.

Contact:
Phone:
Fax:
Email:
Miss. Glenice
86-20-86307137

Send Inquiry
Guangzhou Batai Chemical Co., Ltd.
Room 1101, Building A2, Xinggang International, Country Garden, Xinhua Town, Huadu District, Guangzh
Guangzhou 510800
China
1/14/22 7:04 GMT
C10H14O5 AAEMA Monomer Reduced Resin Viscosity Methacrylic Monomer

AAEMA Monomer Methacrylic Monomer Reduced Resin Viscosity Product Description AAEM readily polymerizes with other acrylic and methacrylic monomers. It is a methacrylic monomer used to formulate high-solids solution acrylic resins and acrylic emulsions for lower VOC emission industrial and architectural coatings. Chemical name Concentration Additional identification 2-(acetoacetoxy)ethyl methacrylate >95% CAS-No.: 21282-97-3 EC No.: 244-311-1 2-hydroxyethyl methacrylate <5% CAS-No.: 868-77-9 EC No.: 212-782-2 INDEX No.: 607-124-00-X The ability of AAEM to react with amines and hydrazides makes it an ideal monomer for self-crosslinkable, room temperature cure acrylic emulsions. It also finds use in acetoacetylated polymers crosslinked through chelation with metal ions and for acetoacetylated polymers for producing colorfast fibers. Product Features — Improved adhesion to metal substrates — Low glass transition temperature for improved coating flexibility — Outstanding flexibility and corrosion resistance — Reaction with conventional crosslinkers — Resin viscosity reduction for lower VOC emissions — Room temperature cure, isocyanate-free crosslinking Product Key Applications — Acetoacetylated polymers — Adhesive polymers — Cosmetic polymer intermediate — Pharmaceutical intermediate — Reactive monomer for UV cure applications — Self-crosslinkable acrylic emulsions

Contact:
Phone:
Fax:
Email:
Sales
86-0755-83633241

Send Inquiry
ShenZhen Prechem New Materials Co.,Ltd
Room 3108, Block A, Electronic Technology Building, No. 2070, Shennan Middle Road, Shenzhen, China
Shenzhen 518000
China


SOURCE: Import-Export Bulletin Board (https://www.imexbb.com/)
Result Page:   << Previous   |   35  |   36  |   37  |   38  |   39  |   40  |   41  |   42  |   43  |   44  |   45  |   Next >>

Post an Offer to Sell
Home - Offers to Buy - Business Opportunities - Company Profiles

© 1996-2026 IMEXBB.com. All rights reserved.

IMEXBB.com