Import-Export Bulletin Board Post an Offer to Sell

New here? Please subscribe
to post trade leads. It's FREE!

Other Chemicals


Home > Offers to Sell > Chemicals & Plastics > Other Chemicals > Other Chemicals

Browse leads by category:
    
    Other Chemicals
 
 

Summary of 5/15/26 9:29 GMT:>> Show Compact View
3/3/22 3:09 GMT
SPECIFICATION OF IBERIOTOXIN

CAT K1060-V CAS NO. 129203-60-7 Product Name Iberiotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4230.9 Da Molecular formula C179H276N50O56S7 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) APPLICATION OF IBERIOTOXIN Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel. As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about synthetic route, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/2/22 3:54 GMT
750g Sausage Construction Silicone Sealant Glue RTV Epoxy Resin Structural

Application Tips To obtain a smooth and neat finish, apply masking tape and remove before sealant cres. Paint surfaces completely before applying sealant. Before processing, observe the instructions in our product leaflets and safety data sheets. Product Description GP Acetic cure Silicone Sealant is a one-part, acid and moisture cure, medium modulus silicone sealant that provides durable, pliable, watertight joints and offers outstanding adhesion without priming to most non-porous substrates. Material preparation: For successful bonding, glass must be clean of all dust, dirt and oil. The cleaned glass should be wiped dry immediately with a clean, lint free cloth or blown dry with hot oil free air. DO NOT clean glass with soap and water solutions. Soap residue can cat as a release agent and result in adhesion failure. Clean glass should be handled with clean, lint free gloves or equivalent only. Oils from hands and fingers can act a release agents resulting in adhesion failure.

Contact:
Phone:
Fax:
Email:
Miss. Wang
86-536-15628715885
86-536-15628715885
Send Inquiry
linqu yuanyang adhesive industry co.,ltd.
Donghuan Road, Linqu County, Weifang City, Shandong Province
Weifang 261000
China
3/2/22 2:50 GMT
400g Medical Treatment For Pain Relief Reusable Ice Packs

Tips: There are four main characteristics of the pharmaceutical cold chain: 1. Security In the evaluation of pharmaceutical cold chain transportation services, safety is at the forefront, which is determined by the particularity of logistics objects. 2. Sudden demand Due to the sudden outbreak of too many diseases, which are easily contagious and spread rapidly, the demand for refrigerated medicines is of a sudden nature, which requires high emergency service capabilities of logistics providers. 3. High cost Compared with the cost of ordinary transportation, the cost of cold chain transportation is generally about 80% higher 4. Professionalism The transportation and storage of medicines must be operated within a specific temperature range in accordance with national regulations, and in-transit GPS management must be implemented to achieve traceability of refrigerated medicines. Introduction to use: Cold compress: put it in freezer or freezer (-10℃ -- 20℃) for more than 30 minutes before use. Hot compress: wrap the cold and hot bag with a slightly wet towel, put it into the microwave oven and turn it to medium heat. Heat it for the first time within 60-100 seconds, and feel whether the temperature is appropriate after taking it out. If it is not hot enough, continue heating every 10-20 seconds until it is warm enough. If continuous use, subsequent heating time control in 50-60 seconds (medium heat). Hot water: Soak hot and cold bags in boiling water for about 4 minutes, or reheat for another 1 minute if the temperature is not enough.

Contact:
Phone:
Fax:
Email:
Miss. Liu
86-156-82115428
86-156-82115428
Send Inquiry
Sichuan Aishipaier New Material Technology Co., Ltd.
Room 2010, 20th Floor, IMP Global Metropolis Plaza, No. 318, Dongda Road, Jinjiang District, Chengdu, Sichuan, China
Chengdu 610000
China
1/19/22 3:31 GMT
High Light Transmittance LED White Light Diffusing Powder For Polycarbonate

LED White Light Diffusing Powder With High Light Transmittance For Polytech Masterbatch / Polycarbonate Product Description KS-200 is a silicone plymer resin powder and a kind of effivient LED/LCD light diffusion agent. It's mainly applied to PC, PVC, PMMA ,Color Masterbatch and functional Masterbatch, PET transparent resin and LED. It is effective to increase of light scattering and transmission and emit soft and beautiful light which build a light and comfortable effect. High Light Transmittance LED White Light Diffusing Powder For Polycarbonate 0 Feature 1. Temperature resistance above 300℃, aging resistance, no yellowing, no black spots; 2. High light transmittance, energy saving; less addition and low cost; 3. Narrow particle size distribution and stable optical index; 4. High haze makes the dazzling incident light turn into unobtrusive soft light; 5. Low light loss and high light diffusion efficiency can fully meet the requirements of higher brightness and energy saving of LED lighting, packaging, light diffusion film, etc; 6. In transparent materials such as PC, pet, PMMA, PS and PVC, 0.5-1% of the additive amount can reach more than 86% of the light transmittance and more than 90% of the haze. Application PC,PMMA,PS,ABS and PVC lampshade,light diffusion plate, LED light emitting resin, electronic display board, digital tube lattice, luminous word, cosmetic bottle and color masterbatch or functional masterbatch How to use This product has good dispersion in the resin and directly added into pellets; the dispersion uniformity is better if coating silica bead and precoating liquid.

Contact:
Phone:
Fax:
Email:
Miss. Glenice
86-20-86307137

Send Inquiry
Guangzhou Batai Chemical Co., Ltd.
Room 1101, Building A2, Xinggang International, Country Garden, Xinhua Town, Huadu District, Guangzh
Guangzhou 510800
China
1/14/22 7:04 GMT
C10H14O5 AAEMA Monomer Reduced Resin Viscosity Methacrylic Monomer

AAEMA Monomer Methacrylic Monomer Reduced Resin Viscosity Product Description AAEM readily polymerizes with other acrylic and methacrylic monomers. It is a methacrylic monomer used to formulate high-solids solution acrylic resins and acrylic emulsions for lower VOC emission industrial and architectural coatings. Chemical name Concentration Additional identification 2-(acetoacetoxy)ethyl methacrylate >95% CAS-No.: 21282-97-3 EC No.: 244-311-1 2-hydroxyethyl methacrylate <5% CAS-No.: 868-77-9 EC No.: 212-782-2 INDEX No.: 607-124-00-X The ability of AAEM to react with amines and hydrazides makes it an ideal monomer for self-crosslinkable, room temperature cure acrylic emulsions. It also finds use in acetoacetylated polymers crosslinked through chelation with metal ions and for acetoacetylated polymers for producing colorfast fibers. Product Features — Improved adhesion to metal substrates — Low glass transition temperature for improved coating flexibility — Outstanding flexibility and corrosion resistance — Reaction with conventional crosslinkers — Resin viscosity reduction for lower VOC emissions — Room temperature cure, isocyanate-free crosslinking Product Key Applications — Acetoacetylated polymers — Adhesive polymers — Cosmetic polymer intermediate — Pharmaceutical intermediate — Reactive monomer for UV cure applications — Self-crosslinkable acrylic emulsions

Contact:
Phone:
Fax:
Email:
Sales
86-0755-83633241

Send Inquiry
ShenZhen Prechem New Materials Co.,Ltd
Room 3108, Block A, Electronic Technology Building, No. 2070, Shennan Middle Road, Shenzhen, China
Shenzhen 518000
China
12/29/21 6:48 GMT
solid abrasives

We're supply D-36 The finishing abrasive, It's a solid square abrasive in blue, It's used for gold, silver, platinum, and white gold. Especially white precious metals such as white gold. It is excellent for the side gloss of the frames of glasses. thod of use Rotate the buff attached to the motor or handpiece to apply the light medicine and use it. We are Supply and sale regardless of quantity from small to large. In addition to D-36, we also deal with S&TY-402N(Old name:D-24), S&TY-404N(N-5000)

Minimum Order: 10 long tons

Contact:
Phone:
Fax:
Email:
Honghwa Oh
8210-33224009
8231-2064851
Send Inquiry
senforce
http://www.senforcetrading.com/bbs/board.php?bo_table=s2_1&sca=Surface%20Treatment
yongin 16954
Korea (South)
12/13/21 8:31 GMT
Sodium Dichloroisocyanurate

Sodium dichloroisocyanurate disinfectant, sodium dichloroisocyanurate sdic is a kind of disinfectant. The product has high efficiency and constant performance and has no harm to human beings. It enjoys a good reputation both at home and abroad. SDIC China , as a new high-efficiency special disinfectant for swimming pool and sauna water treatment, can quickly kill intestinal pathogenic bacteria, pyogenic coccus, pathogenic yeast, and inactivate viruses. The effect is stable and long-lasting. HS-CODE: 2933 6929 10 Un No.: 2465 Molecular weight: 219.65 Formula: C3O3N3Cl2Na CAS No.: 2893-78-9 Specification of Sodium Dichloroisocyanurate Feature and Advantage of Sodium Dichloroisocyanurate Strong sterilization. Safe and convenient to use. Wide sterilization range Strong disinfection ability. Non-toxic and harmless. Application of Sodium Dichloroisocyanurate 1. This product can be used in swimming pools, drinking water, industrial circulating-cooling water treatment. 2. It can be used in the disinfection of tableware, sterilization of houses, hotels, hospitals, and public places. It can also be used in environment disinfection of feeding fish, silkworm, livestock, and poultry. 3. Sterilization: Disinfecting in hospital, family, hotel, public place, pharmaceuticals, breeding industry. 4. Moreover, it can be used in shrinkage resistance and weaving of wool, bleaching of textile, and chlorination of rubber. Cautions of Sodium Dichloroisocyanurate 1. Contact with combustible material may cause a fire. 2. SDIC is corrosive, with an irritating smell, and burns to eyes, eye film, skin, etc. contact with the human body is strictly prohibited. In case of accidental contact, it should be washed with water in time, and sent to the hospital for treatment in case of serious contact. 3. Operators should wear protective glasses, rubber gloves, and other labor protection articles. As a sodium dichloroisocyanurate factory, sodium dichloroisocyanurate manufacturer, Rosun has always been adhering to the core development concept of science, quality, health, and environmental protection, adhering to the sacred mission of "Makes The Rivers And Earth Cleaner, Helps Billions Of People Be Healthier.", serving the society, serving the cause of human environmental protection and health! If you want to know more information about our disinfectant factory, please visit our website.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/13/21 8:30 GMT
Skin Disinfectant

Skin disinfectant solution meets WHO guidelines on hand hygiene in health care, liquid type with 50ml,100ml& 500ml package. Application: Surgical hand disinfection, skin disinfection at the injection site, and general object surface disinfection. Germs Killing Rate: 99.999% Double high-efficiency sterilization formula, the effect is safe and reliable, spray type, no-wash quick-drying, quick effect, unique skincare factor, deep care of the hand skin, moisturizing and not drying. chlorhexidine acetate& ethyl alcohol double sterilization and long-term bacteriostasis. Types of Skin Disinfectant 500ml Skin Disinfectant Product usage is efficient against hand intestinal pathogen, pyogenic coccus, saccharomytes, and common pathogens.  100ml Skin Disinfectant Efficient against hand intestinal pathogen, pyogenic coccus, saccharomyces, and common pathogens. 50ml Skin Disinfectant Efficient against hand intestinal pathogen, pyogenic coccus, saccharomyces, and common pathogens.  What Is The Principle of Disinfection? Change the permeability of the cell membrane of pathogenic microorganisms. Interfere and destroy the enzyme system of pathogenic microorganisms. The protein of pathogenic microorganisms is coagulated and denatured. Inhibition of bacterial metabolic enzyme system. As one of the reliable disinfectant manufacturers, we also have disinfectant safe for skin for sale, if you have needs, please contact us.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/13/21 8:29 GMT
Roxycide for Veterinary Disinfection

Advantages of Roxycide Veterinary Disinfectant Products Activated Oxygen + Hypochlorous Acid for continuous long term activity and efficacy against biofilms Fast Acting, killing most pathogens within 5 to 10 minutes Wide applications and compatible with standard application methods - surface spray, water systems, nebulizers, aerosol Non-toxic and non-irritant at recommended dilutions Biodegradable and environmentally friendly Solution stable for 7 days. Video of RoxycideTM for Veterinary Disinfection Roxycide™- A Trusted Shield for Farm Disinfectant Prevention: Proven Efficacy Against Bacteria, Virus, Fungi High Quality Disinfectant Fast Acting High Activity Against Biofilms The Disinfectant Safe for Animals Owns Wide Applications: Surface, Aerial, Water Livestock Environmentally Friendly Poultry, Swine, Aquaculture, Pet, Dairy, Industrial Roxycide™ Disinfectant in Poultry Farm Applications The Roxycide disinfectant has many usages, which makes it not only a disinfectant used in poultry farm. Roxycide™ Vet Disinfectant Activity Spectrum Roxycide disinfectant powder disinfects livestock housing, surfaces, and equipment. It has been proven effective against more than 500 strains of viruses, bacteria and fungi including African Swine Fever, Foot and Mouth Disease, (FMD), Avian Influenza, Salmonella, and Campylobacter. Roxycide™ Veterinary Disinfectant Cleaner Application Strategies How to make a ready-to-use disinfectant solution? Recommendations for Disinfection Spary for Poultry Farm and Livestock Aerosol/Atomization disinfection using electric sprayer once every 1-2 days Dilution rate: 50 grams Roxycide™ powder to 10 liters of water Application rate: 20-40 ml per cubic meter Use electric aerosol sprayers during the hot season to reduce temperature and heat stress prevention Dilution rate: 20 grams Roxycide™ powder to 15 liters water Application rate: 60 ml per cubic meter During periods of animal stress or epidemic in presence of animals Dilution rate: 50 grams Roxycide™ powder to 10 liters water Application rate: 40 ml per cubic meter, 1-2 times per day for 3-5 days Note: In summer, suggest spraying in the early morning with closed ventilation Safety Do not exceed the equivalent of 5 grams of Roxycide™ powder per kg of body weight The Strategy of Roxycide for Veterinary Disinfection There are many disinfectant suppliers, but we are the best choice for you.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/13/21 8:28 GMT
Roxycide for Aquaculture Disinfection

Roxycide™ an activated oxygen disinfectant that provides solutions for four key challenges for the Aquaculture industry: Pathogen Control: a highly effective disinfectant against both bacteria and viral pathogens Biosecurity: an effective tool in the prevention of disease transmission and management Pond Ecology Management: a mode of action that donates oxygen to the water while helping to manage organic matter Eco-friendly: active constituents degrade to inert and safe substances allowing ongoing and extended usage in the presence of aqua species. Key Benefits in Aquaculture of Roxycide for Aquarium Disinfectant The high quality disinfectant has application flexibility to address key production stages including pond preparation, ongoing water management, and disease outbreaks. Increases oxygen levels in water to help sustain maximum production in ponds and maintain a sustainable pond ecology. Highly effective in the presence of organic matter. Highly effective in Aquaculture to control and eradicate bacteria, fungi, molds, and all viral families affecting Fish, Shrimp, Crab, and other Aquatics. The disinfectant for livestock is used to prevent bacterial diseases including gill-rot, white spot disease, ascites, enteritis, putrid skin disease, decayed crusta disease, saprolegniasis. Spectrum Applications of Roxycide for Fish Tank Sanitizer Roxycide for Aquaculture Disinfection Application Strategy of Roxycide for Aquaculture Disinfection Roxycide for Aquaculture Disinfection Roxycide™ Usage Instructions of Roxycide for Aquaculture Disinfection Do not attempt to pour Roxycide™ Powder directly into aqua ponds. Calculate the volume of water in the pond in cubic meters (m3). Select the desired application and dosage required from the table above. Calculate dosage depending on the volume of water in the pond. Always make a base/stock solution by dissolving the required quantity of Roxycide™ powder into fresh, air temperature water at a ratio of 1:100 for best results (example; 1kg Roxycide™ to 100 liters water). Use a clean container of sufficient size (example 200 liter drums or 1000 liter IBCs) To make the base/stock solution, mix the required amount of Roxycide™ powder into water, while stirring or agitating to helpfully dissolve Roxycide™ in the base solution water. Evenly distribute the base solution to the pond, ideally where there is water movement or aeration paddles to aid in dispersal. Clean and disinfect containers and equipment after. Storage of stock solution: 5-7days. Roxycide™ Application and Dosage Directions of Roxycide for Aquaculture Disinfection How to Sanitize a Fish Tank First, you should clean up the fish tank. next, put the aquaculture disinfectant in a spray bottle and use an 8:1 water/bleach ratio to make a spray. Spray the fish tank and clean it up. Then you leave the tank to dry. Once the tank has been left to dry for 24 hours, fill it with water. If the disinfectant contains chlorine, remember to add a de-chlorinator. Empty the tank and add the de-chlorinator again to make sure it is void of chlorine., and the tank is now ready to use. As a manufacturer of disinfectant, we have various products of disinfectant for sale, any needs, contact us.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/13/21 8:27 GMT
Personal Care

Rosun hand personal hygiene products, personal care products with a unique formula, the broad-spectrum killing of intestinal pathogens, pyogenic cocci, pathogenic yeasts, and other common hospital pathogens. With unique skincare factor, deeply nourishes hand skin, moisturizes not dry. One-way pump head aseptic design, easy to use, safe, and hygienic. Quick spray type, short action time, quick effect, little skin damage. Feminine Hygiene products with a safe and efficient antibacterial formula, which can quickly kill all kinds of common pathogens causing perineal red, swollen, hot, painful, itchy, and other infection symptoms. Oral Hygiene products with highly effective bactericidal ingredient dp300, 12 hours long-term antibacterial, professional prevention and treatment of various oral inflammation. Types of Personal Care Products Hand Sanitizer 500ml Hand Sanitizer Our 3D tempered glass is curved by precision hot bending machine with more larger radio on the edge and feels smooth. Hand Sanitizer Gel 100ml Hand Sanitizer Gel 500ml Hand Sanitizer Gel Waterless Hand Cleaner Gel Our 3D tempered glass is curved by a precision hot bending machine with larger radio on the edge and feels smooth. Skin Disinfectant 500ml Skin Disinfectant 100ml Skin Disinfectant 50ml Skin Disinfectant Our 3D tempered glass is curved by a precision hot bending machine with larger radio on the edge and feels smooth. Special Hand Wash 500ml Hand Wash Our 3D tempered glass is curved by precision hot bending machine with more larger radio on the edge and feels smooth. Child Friendly Hand Sanitizer Our 3D tempered glass is curved by a precision hot bending machine with larger radio on the edge and feels smooth. Feminine Wash Feminine Wash has the effect of cleaning, moistening, and sterilizing. Mouth Wash Rosun antiviral mouthwash can effectively against bacteria, fungi, and viruses.  FAQ of Personal Care  Why Is Personal Care Important? Good personal care/hygiene is one of the best ways to prevent disease. Handwashing with hand sanitizer gel can remove pathogenic bacteria. Good personal hygiene can also prevent diseases from spreading to others.  Hand Hygiene Steps - Wash Hand  What Disinfectant Is Safe For Chickens?  What Is Water Treatment Steps? As personal care products company, personal care products manufacturer, we will attempt to meet all customers’ needs. We have personal care products wholesale, and the personal care products price is affordable if you have needs, please contact us. If you want to know more sorts of China disinfectant, please visit our website.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/13/21 8:26 GMT
Mouth Wash

types of antiseptic mouthwash mouthwash oral different mouthwashes mouth wash cost bulk mouthwash mouthwash companies different types of mouthwash oral wash / mouthwash oral Rosun antiviral bulk mouthwash contains chlorhexidine acetate and trichloro hydroxy diphenyl ether, which can effectively against bacteria, fungi, and viruses. It has an antibacterial effect on plaque, halitosis, periodontitis, gingivitis, gingival bleeding, periodontal abscess, oral mucosal ulcer, and other oral problems caused by bacteria. It can be used for the prevention of oral harmful bacteria and postoperative nursing of oral surgery. Antibacterial mouthwash with a variety of plant extracts, the taste is cool, comfortable, mild, and not irritating. It can quickly remove the bad smell of the mouth, keep the breath fresh for a long time, and maintain the balance of oral flora. Specification of Mouth Wash Main Ingredients: Chlorhexidine acetate and herbal Features: No alcohol, no antibiotics Main Functions of Mouth Wash1. Elimination of Oral Odor Elimination of oral odor Effective removal of harmful bacteria causing oral odor Comprehensive oral cleansing Deep into the whole mouth, cleaner and more thorough Herbal mild nursing Add herbal essence to maintain oral mucosa mildly Maintaining gingival health Prevent and improve oral problems such as gingivitis, periodontitis, and gingival bleeding Relieve oral ulcers Effectively prevent and improve oral ulcer and other mucosal problems Clean up oral bacteria Eliminate harmful bacteria and inhibit bacterial growth Recommended by the Chinese Nursing Association Application Scenarios of Mouth Wash If you want to know more information about types of antiseptic mouthwash and oral wash, please visit our website. As a manufacturer of disinfectant, we will peovide more high quality products to customers.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/13/21 8:25 GMT
Membrane Bioreactor

MBR China (Membrane Bio reactors) is a membrane separation technology with biological degradation. The membrane module can take the places of the secondary sedimentation tank, a large number of microorganisms are intercepted, which can increase the quantity of microflora, improve the sewage treatment capacity and efficiency, so that the effluent quality and volume load have been greatly improved, and the water can be used as reclaimed water. The core component of the MBR is high-performance submerged membrane components. Compare with the traditional method (pressure filter), the membrane negative pressure suction type filtering method using aeration to operation a sable mbr filter membrane in the system. Technical Process and Comparison of Membrane Bioreactor The pollutant in sewage water will firstly biodegradation in a bioreactor, at the same time, because of the function of the pressure difference, the water, and some small-molecule solute which smaller than the aperture of the membrane in the mixed liquid will pass the membrane, and then become the treated water. Microorganisms and macro solute will be intercepted by the membrane, so it replaced the sedimentation tank by complete its water treatment and separate function. Work Principle of MBR Membrane Filter Bioreactor Use the PVDF as the main material, Rosun flat sheet membrane with good stability of chemicals used in wastewater treatment, fouling resistance, and mechanical strength, has different types according to its efficacy area. Product Details of Membrane Biological Reactor Advantages of membrane biological reactor wastewater treatment Advanced material: The main material of the membrane is PVDF, which has excellent chemical stability, permeate flux, permeate quality, and fouling resistance. Better outlet water quality: The pore size of Rosun flat sheet membrane is around 0.1micron, and with advanced membrane technology increased the effective orifice area of the membrane surface then leads to excellent permeate flux and permeate quality. The output water can be reused directly. Higher activated sludge adaption of Membrane Bioreactor: Compared with the hollow fiber curtain membrane whose activated sludge adaption is only 4000-6000mg/L, Rosun flat sheet membrane can adapt 8000-15000mg/L activated sludge. Longer service life: Compared with hollow fiber curtain membrane, Rosun flat sheet have a longer service life of 3-6 years compared with 1-3years of service life of hollow fiber curtain membrane. Less land space: The MBR reactor tank can replace the function of a secondary sedimentation tank with an anaerobic tank, it can save 30% of land space. Easy to operate and maintenance: The flat sheet membrane can be just replaced a single damaged piece without change the holder when damage and replacement, replace just need 15 minutes. As a membrane filtration company we have high quality relative products for sale, and the mbr membrane price is low, so if you have any needs to buy anything, please contact us. Established in 2002, Chengdu Rosun is a manufacturer of disinfectant, if you have any doubts, please contact us.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/7/21 3:34 GMT
Hot sale High Quality High Strength 3mm 6mm 9mm PP Staple Fiber

Hot sale High Quality High Strength 3mm 6mm 9mm PP Staple Fiber for Construction Industry Hot sale, High quality, high strength 3mm, 6mm, 9mm PP staple fiber for construction industry is also called anti-cracking fiber, PP fiber, building material fiber, and construction fiber. Polypropylene staple fiber is a high- strength bundled monofilament fiber made from polypropylene. The addition of mortar concrete can effectively control the micro-cracks caused by the solid plastic shrinkage, dry shrinkage, temperature change and other factors of the concrete (mortar), prevent and inhibit the formation and development of cracks, and greatly improve the crack resistance, impermeability, impact resistance and Earthquake resistance. SPECIFICATIONS Crack Resistant Staple Fiber SPECIFICATION MATERIAL 100% Polypropylene / PP FIBER STYLE SOLID  Monofilament Fiber Length 3mm 6mm 9mm 12mm Fiber Dia 18~20 UM/18~48UM COLOR White Usage Cement Mortar Concrete Filling Material Building Surface Density 0.91g/cm3 Elastic Modulus 3500MPa-3850MPA Tensile Strength ≥450MPA MELTING Points 280-350/160-180 Elongation At Break 10%-28% Delivery Time 4-7 Days  Supply Ability 3000 Tons Each Month Port Tianjin Xingang and Qingdao Resistance to Acid, Alkali Strong Water Absorbency No Packaging 2KGS Per OPP/PP/PE Bag Inside, 20KGS/Weaving Bag Outside Feature Anti-Distortion, Anti-Static, Anti-pilling, Flame Retardant, ANTI- Abrasio Acid, Alkali & Salt Resistance. Port Tianjin Xingang and Qingdao Delivery Time 4-7 Days PRODUCT ADVANTAGE 1. Prevent concrete cracks. 2. Improve the permeability of concrete. 3. Improve the freeze-thaw resistance of concrete. 4. Improve the impact resistance, flexural resistance, fatigue resistance and seismic performance of concrete. 5. Improve the durability and aging resistance of concrete. 6. Improve the fire resistance of concrete SPECIFICATION 3mm,6mm,9mm AP , PLICATION Put cement, aggregate, additive and fiber together, then stir after adding enough water and time for stirring can be prolonged for 2-3 minutes in order to make the compound mix completely. Also it can be mixed even with cement and other aggregates in advance, stirring by adding water at worksite before constructing.

Contact:
Phone:
Fax:
Email:
TONG BO SHAO
031186902578

Send Inquiry
Hebei Tangpeng Import & Export Trading Co., Ltd.
ROOM 315, JINJIAYUAN ESTATE, NO. 528 HEPING EAST ROAD, CHANG'AN AREA
SHIJIAZHUANG 050000
China
12/7/21 3:33 GMT
Highest Level Wholesale MHEC HEMC Chemical Powder for Tile Adhesive

Highest Level Wholesale MHEC HEMC Chemical Powder for Tile Adhesive Hydroxyethyl Methyl Cellulose (MHEC) is used in Tile adhesive. Cellulose MHEC is a natural polymer cellulose made by a series of chemical treatments . Water- soluble white powder. MHEC has high temperature stability, especially in summer, when the wall temperature is high, MHEC has good water retention performance at high temperature It can greatly improve the bonding strength between facing material and base material, and has good resistance to sliding and has excellent water resistance, heat resistance and resistance to freezing and thawing cycle etc, and is mainly used to paste the wall brick and floor tile decorative materials, widely used in internal and external walls, floor, bathroom, kitchen, such as construction of veneer decoration, It is the most widely used ceramic tile bonding material. ADVANTAGE It has thickened, adhesion, dispersion, emulsification, film formation, suspension, adsorption, gel and protective colloid surface activity, and retains moisture and other characteristics . SPECIFICATION MHEC SPECIFICATION HYDROXYL ETHYL Group % 4.0-12.0 METHOXY 19.0-24.0 WATER 5% MAX(≤5%) THE ASH 5% MAX(≤5%) VISCOSITY 5-200000 MPA.S or be customized according to your requirements. GEL TEMPERATURE 68-90℃ CAS No. 9032-42-2 Grade Standard In the Construction Industry Applications In Coatings Industry Applications In Daily Chemical Engineering Application Purity 99% PH Value 5-8 Appearance White Powder or White-like Powder APPLICATION Usage of MHEC: Coating auxiliary agents, wall putty, tile adhesives, mortar, gypsum plaster, skim coat, screed etc. 

Contact:
Phone:
Fax:
Email:
TONG BO SHAO
031186902578

Send Inquiry
Hebei Tangpeng Import & Export Trading Co., Ltd.
ROOM 315, JINJIAYUAN ESTATE, NO. 528 HEPING EAST ROAD, CHANG'AN AREA
SHIJIAZHUANG 050000
China


SOURCE: Import-Export Bulletin Board (https://www.imexbb.com/)
Result Page:   << Previous   |   36  |   37  |   38  |   39  |   40  |   41  |   42  |   43  |   44  |   45  |   46  |   Next >>

Post an Offer to Sell
Home - Offers to Buy - Business Opportunities - Company Profiles

© 1996-2026 IMEXBB.com. All rights reserved.

IMEXBB.com