Import-Export Bulletin Board Post an Offer to Sell

New here? Please subscribe
to post trade leads. It's FREE!

Other Chemicals


Home > Offers to Sell > Chemicals & Plastics > Other Chemicals > Other Chemicals

Browse leads by category:
    
    Other Chemicals
 
 

Summary of 12/6/25 2:04 GMT:>> Show Compact View
3/3/22 3:21 GMT
MODIFIED HISTONE

As a professional peptide company in China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, from ug to g with 70% to 99% purity, can also be made according to your requirements. Modified histones can be applied to nucleosome assembly and the subsequent study of biochemical function and structure. Histones are proteins that condense and package DNA neatly into chromosomes. Different types of histone modifications affect different processes in the cell such as the activation/ inactivation of transcription, chromosome packaging, DNA damage and DNA repair. The histone modifications is an important post- translational process that plays a key role in gene expression. Histone modifications impact gene expression by changing the structure of chromatin or through the recruitment of histone modifiers. Histones pack DNA into structures called nucleosomes, to fit the DNA molecule into the nucleus. Each of these nucleosomes has two subunits, each comprising the core histone H2A protein, histone H2B protein, histone H3 protein and histone H4 peptide, and a linker histone called H1 that acts as a stabilizer. If you want to know the process of peptide manufacturing, please contact us.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:16 GMT
MAMBALGIN 1

ASIC1 channels, Mambalgin 1 is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. 1609937-15-6 Product Name Mambalgin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 6554.5 Da Molecular formula C272H429N85O84S10 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETEN , NKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) APPLICATION OF MAMBALGIN 1 Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells. As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us. More information about our pre clinical trial, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:14 GMT
L CARNOSINE

L Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs in high concentrations in muscle and brain tissue. SPECIFICATION OF L CARNOSINE Purity(HPLC) ≥98% Content ≥99% 20% below market price 1000+kg per month Fast delivery APPLICATION OF L CARNOSINE Product Name L-Carnosine β-Alanyl-L-histidine H-β-Ala-His-OH CAS-No. 305-84-0 Molecular Formula C9H14N4O3 Sequence β-Ala-His Molecular Weight 226.232g/mol Package 1kg, 25kg, customizable Appearance White powder Application Cosmetic raw materials Storage 2~8℃ Efficacy and Mechanism of Action: Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water- borne antioxidant with wound healing activity and naturally occurs in high concentrations in muscle and brain tissue. Carnosine is an unsaturated aldehyde that scavenges reactive oxygen species and peroxidizes fatty acids in cell membranes during oxidative stress. Low molecular weight water-soluble unmodified dipeptide-Ala-His has very little affinity for skin and does not penetrate beyond the first layer of cuticle. However, the lipophilic peptide palmitoyl-Ala-His diffused into the cuticle, epidermis, and dermis, and no systemic activity was observed. If you want to know more about l carnosine price, please contact us. As a peptide supplier, we will produce more high quality products for customers, if you have needs, please contact us. More information about our chemical structure identification, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:13 GMT
KURTOXIN

SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. 820959-57-7 Product Name kurtoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 7386.36 Molecular formula C324H478N94O90S8 Source Peptides Synthesis Storage Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence KIDGYPVDYW NCKRICWYNN KYCNDLCKGL KADSGYCWGW TLSCYCQGLP DNARIKRSGR CRA (Modifications: Disulfide bonds: 12-61, 16-37, 23-44, 27-46) APPLICATION OF KKURTOXIN Kurtoxin, a 63-amino acid peptide stabilized by four disulfide bonds, is the first reported peptide inhibitor of T-type voltage-gated calcium channels If you want to know more about peptide polypeptide, please contact us.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:12 GMT
KALIOTOXIN

The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels. SPECIFICATION OF KALIOTOXIN CAT K1070-V CAS NO. 145199-73-1 Product Name Kaliotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4149.89 Da Molecular formula C171H283N55O49S6 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) APPLICATION OF KALIOTOXIN Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system. As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about peptide library, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:09 GMT
SPECIFICATION OF IBERIOTOXIN

CAT K1060-V CAS NO. 129203-60-7 Product Name Iberiotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4230.9 Da Molecular formula C179H276N50O56S7 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) APPLICATION OF IBERIOTOXIN Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel. As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about synthetic route, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/2/22 3:54 GMT
750g Sausage Construction Silicone Sealant Glue RTV Epoxy Resin Structural

Application Tips To obtain a smooth and neat finish, apply masking tape and remove before sealant cres. Paint surfaces completely before applying sealant. Before processing, observe the instructions in our product leaflets and safety data sheets. Product Description GP Acetic cure Silicone Sealant is a one-part, acid and moisture cure, medium modulus silicone sealant that provides durable, pliable, watertight joints and offers outstanding adhesion without priming to most non-porous substrates. Material preparation: For successful bonding, glass must be clean of all dust, dirt and oil. The cleaned glass should be wiped dry immediately with a clean, lint free cloth or blown dry with hot oil free air. DO NOT clean glass with soap and water solutions. Soap residue can cat as a release agent and result in adhesion failure. Clean glass should be handled with clean, lint free gloves or equivalent only. Oils from hands and fingers can act a release agents resulting in adhesion failure.

Contact:
Phone:
Fax:
Email:
Miss. Wang
86-536-15628715885
86-536-15628715885
Send Inquiry
linqu yuanyang adhesive industry co.,ltd.
Donghuan Road, Linqu County, Weifang City, Shandong Province
Weifang 261000
China
3/2/22 2:50 GMT
400g Medical Treatment For Pain Relief Reusable Ice Packs

Tips: There are four main characteristics of the pharmaceutical cold chain: 1. Security In the evaluation of pharmaceutical cold chain transportation services, safety is at the forefront, which is determined by the particularity of logistics objects. 2. Sudden demand Due to the sudden outbreak of too many diseases, which are easily contagious and spread rapidly, the demand for refrigerated medicines is of a sudden nature, which requires high emergency service capabilities of logistics providers. 3. High cost Compared with the cost of ordinary transportation, the cost of cold chain transportation is generally about 80% higher 4. Professionalism The transportation and storage of medicines must be operated within a specific temperature range in accordance with national regulations, and in-transit GPS management must be implemented to achieve traceability of refrigerated medicines. Introduction to use: Cold compress: put it in freezer or freezer (-10℃ -- 20℃) for more than 30 minutes before use. Hot compress: wrap the cold and hot bag with a slightly wet towel, put it into the microwave oven and turn it to medium heat. Heat it for the first time within 60-100 seconds, and feel whether the temperature is appropriate after taking it out. If it is not hot enough, continue heating every 10-20 seconds until it is warm enough. If continuous use, subsequent heating time control in 50-60 seconds (medium heat). Hot water: Soak hot and cold bags in boiling water for about 4 minutes, or reheat for another 1 minute if the temperature is not enough.

Contact:
Phone:
Fax:
Email:
Miss. Liu
86-156-82115428
86-156-82115428
Send Inquiry
Sichuan Aishipaier New Material Technology Co., Ltd.
Room 2010, 20th Floor, IMP Global Metropolis Plaza, No. 318, Dongda Road, Jinjiang District, Chengdu, Sichuan, China
Chengdu 610000
China
1/19/22 3:31 GMT
High Light Transmittance LED White Light Diffusing Powder For Polycarbonate

LED White Light Diffusing Powder With High Light Transmittance For Polytech Masterbatch / Polycarbonate Product Description KS-200 is a silicone plymer resin powder and a kind of effivient LED/LCD light diffusion agent. It's mainly applied to PC, PVC, PMMA ,Color Masterbatch and functional Masterbatch, PET transparent resin and LED. It is effective to increase of light scattering and transmission and emit soft and beautiful light which build a light and comfortable effect. High Light Transmittance LED White Light Diffusing Powder For Polycarbonate 0 Feature 1. Temperature resistance above 300℃, aging resistance, no yellowing, no black spots; 2. High light transmittance, energy saving; less addition and low cost; 3. Narrow particle size distribution and stable optical index; 4. High haze makes the dazzling incident light turn into unobtrusive soft light; 5. Low light loss and high light diffusion efficiency can fully meet the requirements of higher brightness and energy saving of LED lighting, packaging, light diffusion film, etc; 6. In transparent materials such as PC, pet, PMMA, PS and PVC, 0.5-1% of the additive amount can reach more than 86% of the light transmittance and more than 90% of the haze. Application PC,PMMA,PS,ABS and PVC lampshade,light diffusion plate, LED light emitting resin, electronic display board, digital tube lattice, luminous word, cosmetic bottle and color masterbatch or functional masterbatch How to use This product has good dispersion in the resin and directly added into pellets; the dispersion uniformity is better if coating silica bead and precoating liquid.

Contact:
Phone:
Fax:
Email:
Miss. Glenice
86-20-86307137

Send Inquiry
Guangzhou Batai Chemical Co., Ltd.
Room 1101, Building A2, Xinggang International, Country Garden, Xinhua Town, Huadu District, Guangzh
Guangzhou 510800
China
1/14/22 7:04 GMT
C10H14O5 AAEMA Monomer Reduced Resin Viscosity Methacrylic Monomer

AAEMA Monomer Methacrylic Monomer Reduced Resin Viscosity Product Description AAEM readily polymerizes with other acrylic and methacrylic monomers. It is a methacrylic monomer used to formulate high-solids solution acrylic resins and acrylic emulsions for lower VOC emission industrial and architectural coatings. Chemical name Concentration Additional identification 2-(acetoacetoxy)ethyl methacrylate >95% CAS-No.: 21282-97-3 EC No.: 244-311-1 2-hydroxyethyl methacrylate <5% CAS-No.: 868-77-9 EC No.: 212-782-2 INDEX No.: 607-124-00-X The ability of AAEM to react with amines and hydrazides makes it an ideal monomer for self-crosslinkable, room temperature cure acrylic emulsions. It also finds use in acetoacetylated polymers crosslinked through chelation with metal ions and for acetoacetylated polymers for producing colorfast fibers. Product Features — Improved adhesion to metal substrates — Low glass transition temperature for improved coating flexibility — Outstanding flexibility and corrosion resistance — Reaction with conventional crosslinkers — Resin viscosity reduction for lower VOC emissions — Room temperature cure, isocyanate-free crosslinking Product Key Applications — Acetoacetylated polymers — Adhesive polymers — Cosmetic polymer intermediate — Pharmaceutical intermediate — Reactive monomer for UV cure applications — Self-crosslinkable acrylic emulsions

Contact:
Phone:
Fax:
Email:
Sales
86-0755-83633241

Send Inquiry
ShenZhen Prechem New Materials Co.,Ltd
Room 3108, Block A, Electronic Technology Building, No. 2070, Shennan Middle Road, Shenzhen, China
Shenzhen 518000
China
12/29/21 6:48 GMT
solid abrasives

We're supply D-36 The finishing abrasive, It's a solid square abrasive in blue, It's used for gold, silver, platinum, and white gold. Especially white precious metals such as white gold. It is excellent for the side gloss of the frames of glasses. thod of use Rotate the buff attached to the motor or handpiece to apply the light medicine and use it. We are Supply and sale regardless of quantity from small to large. In addition to D-36, we also deal with S&TY-402N(Old name:D-24), S&TY-404N(N-5000)

Minimum Order: 10 long tons

Contact:
Phone:
Fax:
Email:
Honghwa Oh
8210-33224009
8231-2064851
Send Inquiry
senforce
http://www.senforcetrading.com/bbs/board.php?bo_table=s2_1&sca=Surface%20Treatment
yongin 16954
Korea (South)
12/13/21 8:31 GMT
Sodium Dichloroisocyanurate

Sodium dichloroisocyanurate disinfectant, sodium dichloroisocyanurate sdic is a kind of disinfectant. The product has high efficiency and constant performance and has no harm to human beings. It enjoys a good reputation both at home and abroad. SDIC China , as a new high-efficiency special disinfectant for swimming pool and sauna water treatment, can quickly kill intestinal pathogenic bacteria, pyogenic coccus, pathogenic yeast, and inactivate viruses. The effect is stable and long-lasting. HS-CODE: 2933 6929 10 Un No.: 2465 Molecular weight: 219.65 Formula: C3O3N3Cl2Na CAS No.: 2893-78-9 Specification of Sodium Dichloroisocyanurate Feature and Advantage of Sodium Dichloroisocyanurate Strong sterilization. Safe and convenient to use. Wide sterilization range Strong disinfection ability. Non-toxic and harmless. Application of Sodium Dichloroisocyanurate 1. This product can be used in swimming pools, drinking water, industrial circulating-cooling water treatment. 2. It can be used in the disinfection of tableware, sterilization of houses, hotels, hospitals, and public places. It can also be used in environment disinfection of feeding fish, silkworm, livestock, and poultry. 3. Sterilization: Disinfecting in hospital, family, hotel, public place, pharmaceuticals, breeding industry. 4. Moreover, it can be used in shrinkage resistance and weaving of wool, bleaching of textile, and chlorination of rubber. Cautions of Sodium Dichloroisocyanurate 1. Contact with combustible material may cause a fire. 2. SDIC is corrosive, with an irritating smell, and burns to eyes, eye film, skin, etc. contact with the human body is strictly prohibited. In case of accidental contact, it should be washed with water in time, and sent to the hospital for treatment in case of serious contact. 3. Operators should wear protective glasses, rubber gloves, and other labor protection articles. As a sodium dichloroisocyanurate factory, sodium dichloroisocyanurate manufacturer, Rosun has always been adhering to the core development concept of science, quality, health, and environmental protection, adhering to the sacred mission of "Makes The Rivers And Earth Cleaner, Helps Billions Of People Be Healthier.", serving the society, serving the cause of human environmental protection and health! If you want to know more information about our disinfectant factory, please visit our website.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/13/21 8:30 GMT
Skin Disinfectant

Skin disinfectant solution meets WHO guidelines on hand hygiene in health care, liquid type with 50ml,100ml& 500ml package. Application: Surgical hand disinfection, skin disinfection at the injection site, and general object surface disinfection. Germs Killing Rate: 99.999% Double high-efficiency sterilization formula, the effect is safe and reliable, spray type, no-wash quick-drying, quick effect, unique skincare factor, deep care of the hand skin, moisturizing and not drying. chlorhexidine acetate& ethyl alcohol double sterilization and long-term bacteriostasis. Types of Skin Disinfectant 500ml Skin Disinfectant Product usage is efficient against hand intestinal pathogen, pyogenic coccus, saccharomytes, and common pathogens.  100ml Skin Disinfectant Efficient against hand intestinal pathogen, pyogenic coccus, saccharomyces, and common pathogens. 50ml Skin Disinfectant Efficient against hand intestinal pathogen, pyogenic coccus, saccharomyces, and common pathogens.  What Is The Principle of Disinfection? Change the permeability of the cell membrane of pathogenic microorganisms. Interfere and destroy the enzyme system of pathogenic microorganisms. The protein of pathogenic microorganisms is coagulated and denatured. Inhibition of bacterial metabolic enzyme system. As one of the reliable disinfectant manufacturers, we also have disinfectant safe for skin for sale, if you have needs, please contact us.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/13/21 8:29 GMT
Roxycide for Veterinary Disinfection

Advantages of Roxycide Veterinary Disinfectant Products Activated Oxygen + Hypochlorous Acid for continuous long term activity and efficacy against biofilms Fast Acting, killing most pathogens within 5 to 10 minutes Wide applications and compatible with standard application methods - surface spray, water systems, nebulizers, aerosol Non-toxic and non-irritant at recommended dilutions Biodegradable and environmentally friendly Solution stable for 7 days. Video of RoxycideTM for Veterinary Disinfection Roxycide™- A Trusted Shield for Farm Disinfectant Prevention: Proven Efficacy Against Bacteria, Virus, Fungi High Quality Disinfectant Fast Acting High Activity Against Biofilms The Disinfectant Safe for Animals Owns Wide Applications: Surface, Aerial, Water Livestock Environmentally Friendly Poultry, Swine, Aquaculture, Pet, Dairy, Industrial Roxycide™ Disinfectant in Poultry Farm Applications The Roxycide disinfectant has many usages, which makes it not only a disinfectant used in poultry farm. Roxycide™ Vet Disinfectant Activity Spectrum Roxycide disinfectant powder disinfects livestock housing, surfaces, and equipment. It has been proven effective against more than 500 strains of viruses, bacteria and fungi including African Swine Fever, Foot and Mouth Disease, (FMD), Avian Influenza, Salmonella, and Campylobacter. Roxycide™ Veterinary Disinfectant Cleaner Application Strategies How to make a ready-to-use disinfectant solution? Recommendations for Disinfection Spary for Poultry Farm and Livestock Aerosol/Atomization disinfection using electric sprayer once every 1-2 days Dilution rate: 50 grams Roxycide™ powder to 10 liters of water Application rate: 20-40 ml per cubic meter Use electric aerosol sprayers during the hot season to reduce temperature and heat stress prevention Dilution rate: 20 grams Roxycide™ powder to 15 liters water Application rate: 60 ml per cubic meter During periods of animal stress or epidemic in presence of animals Dilution rate: 50 grams Roxycide™ powder to 10 liters water Application rate: 40 ml per cubic meter, 1-2 times per day for 3-5 days Note: In summer, suggest spraying in the early morning with closed ventilation Safety Do not exceed the equivalent of 5 grams of Roxycide™ powder per kg of body weight The Strategy of Roxycide for Veterinary Disinfection There are many disinfectant suppliers, but we are the best choice for you.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China
12/13/21 8:28 GMT
Roxycide for Aquaculture Disinfection

Roxycide™ an activated oxygen disinfectant that provides solutions for four key challenges for the Aquaculture industry: Pathogen Control: a highly effective disinfectant against both bacteria and viral pathogens Biosecurity: an effective tool in the prevention of disease transmission and management Pond Ecology Management: a mode of action that donates oxygen to the water while helping to manage organic matter Eco-friendly: active constituents degrade to inert and safe substances allowing ongoing and extended usage in the presence of aqua species. Key Benefits in Aquaculture of Roxycide for Aquarium Disinfectant The high quality disinfectant has application flexibility to address key production stages including pond preparation, ongoing water management, and disease outbreaks. Increases oxygen levels in water to help sustain maximum production in ponds and maintain a sustainable pond ecology. Highly effective in the presence of organic matter. Highly effective in Aquaculture to control and eradicate bacteria, fungi, molds, and all viral families affecting Fish, Shrimp, Crab, and other Aquatics. The disinfectant for livestock is used to prevent bacterial diseases including gill-rot, white spot disease, ascites, enteritis, putrid skin disease, decayed crusta disease, saprolegniasis. Spectrum Applications of Roxycide for Fish Tank Sanitizer Roxycide for Aquaculture Disinfection Application Strategy of Roxycide for Aquaculture Disinfection Roxycide for Aquaculture Disinfection Roxycide™ Usage Instructions of Roxycide for Aquaculture Disinfection Do not attempt to pour Roxycide™ Powder directly into aqua ponds. Calculate the volume of water in the pond in cubic meters (m3). Select the desired application and dosage required from the table above. Calculate dosage depending on the volume of water in the pond. Always make a base/stock solution by dissolving the required quantity of Roxycide™ powder into fresh, air temperature water at a ratio of 1:100 for best results (example; 1kg Roxycide™ to 100 liters water). Use a clean container of sufficient size (example 200 liter drums or 1000 liter IBCs) To make the base/stock solution, mix the required amount of Roxycide™ powder into water, while stirring or agitating to helpfully dissolve Roxycide™ in the base solution water. Evenly distribute the base solution to the pond, ideally where there is water movement or aeration paddles to aid in dispersal. Clean and disinfect containers and equipment after. Storage of stock solution: 5-7days. Roxycide™ Application and Dosage Directions of Roxycide for Aquaculture Disinfection How to Sanitize a Fish Tank First, you should clean up the fish tank. next, put the aquaculture disinfectant in a spray bottle and use an 8:1 water/bleach ratio to make a spray. Spray the fish tank and clean it up. Then you leave the tank to dry. Once the tank has been left to dry for 24 hours, fill it with water. If the disinfectant contains chlorine, remember to add a de-chlorinator. Empty the tank and add the de-chlorinator again to make sure it is void of chlorine., and the tank is now ready to use. As a manufacturer of disinfectant, we have various products of disinfectant for sale, any needs, contact us.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
enrosun


Send Inquiry
Chengdu Rosun Disinfection Pharmaceutical Co., Ltd
No. 139, East 5th Road, Checheng, Economic and Technological Development ZoneChengdu, Sichuan China
Sichuan 610100
China


SOURCE: Import-Export Bulletin Board (https://www.imexbb.com/)
Result Page:   << Previous   |   38  |   39  |   40  |   41  |   42  |   43  |   44  |   45  |   46  |   47  |   48  |   Next >>

Post an Offer to Sell
Home - Offers to Buy - Business Opportunities - Company Profiles

© 1996-2025 IMEXBB.com. All rights reserved.

IMEXBB.com