Import-Export Bulletin Board Post an Offer to Sell

New here? Please subscribe
to post trade leads. It's FREE!

Offers to Sell


Home > Offers to Sell

Browse leads by category:
    
    
    
    
    
    
    
    
    
    
  

Summary of 4/21/26 15:18 GMT:>> Show Compact View
3/3/22 3:14 GMT
2 Layer ENIG Half Hole PCB

Advantages Of two sided pcb Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 2 Layer ENIG Half Hole PCB As a pcb circuit manufacturer, we will offer high quality products for sale, if you have needs, please contact us.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
hhcircuits
+86 135 3751 8062

Send Inquiry
Xinfeng Huihe Circuits Co., Ltd.
Building 2, Xinda Park, Lvyuan Road, Xinfeng County, Ganzhou 341600, Jiangxi
Ganzhou 341600
China
3/3/22 3:13 GMT
Half Hole & Through Hole Pcb

Half Hole & through hole circuit board, no copper burr residue or warpage in half hole, reduce connectors and save space, apply to Bluetooth module and Signal receiver products. HUIHE CIRCUITS Half Hole & Through Hole PCB, apply to Bluetooth module and Signal receiver products. Has passed ISO9001 / ISO13485 /IATF16949 / UL /RoHS / REACH certification. Half Hole & Through Hole PCB List 2 Layer OSP Impedance Control Half Hole PCB 2 Layer ENIG Half Hole PCB 4 Layer ENIG Impedance Control Half Hole PCB Electric Circuit Board 2 layer ENIG impedance control half hole pcb 8 layer ENIG half hole custom PCB 4 layer ENIG impedance control half hole fr4 PCB 4 layer ENIG impedance control half hole PCB 4 layer LF-HASL half hole PCB Production Process Of Metallized Half-Hole PCB For the front inversion, to prevent the quality of the product and the need to make corrections in the later process, the production process of this type of board is processed according to the following process: a drilling (drilling, gong groove-plate surface plating-external Optical imaging-pattern plating-co- drying-half-hole processing-film stripping, etching, tin stripping-other processes-shape Main Points Of Metallized Half-Hole PCB Production The specific metallized half-holes are processed in the following way: all metallized half-hole PCB holes must be drilled in the pattern after plating, and one hole at the intersection of the two ends of the half-hole should be drilled before etching. The engineering department formulates the MI process according to the process The metal half-hole is the second-drilled half-hole drilled during the first drilling (or gong), after the image is plated, and before the etching. It is necessary to consider whether the copper will be exposed when the gong groove is shaped, and move the drilled half-hole into the unit. he right hole is drilled first, and then the board is turned over (or mirrored) and the left hole is drilled to reduce the pulling of the copper of the inner hole of the half hole by the drill, resulting in the lack of copper of the hole. The size of the drill nozzle for drilling the half hole depends on the spacing of the contour lines. Draw the solder mask film, use the gong space as a stop point and open the window to increase 4mil treatment. The Designer's Suggestion When Designing The Circuit Change the distance from the edge line to the hole center. The general design is to place the hole center on the edge line and move the control center down. For example, the diameter of the hole is 1.4mm, the distance between the two holes is 2.54mm, and the board edge The distance between the line is 0.33mm from the center of the through hole, and the thickness of the plate is 0.6mm. The angle between the tangent to the cut point of the wall and the track of the milling cutter was 90 degrees before, but this time it is about 60 degrees. Because the board edge line is at a certain distance from the center of the through hole, the cutting angle of the milling cutter is changed, and the board thickness is extremely small, so the copper in the hole is not easily pulled out. The simultaneous improvement of small batch pcb design and production can greatly improve the production yield of pcb board with holes. In our circuit board factory, we have types of pcb board for sale, if you have needs, please contact us.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
hhcircuits
+86 135 3751 8062

Send Inquiry
Xinfeng Huihe Circuits Co., Ltd.
Building 2, Xinda Park, Lvyuan Road, Xinfeng County, Ganzhou 341600, Jiangxi
Ganzhou 341600
China
3/3/22 3:13 GMT
KURTOXIN

SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. 820959-57-7 Product Name kurtoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 7386.36 Molecular formula C324H478N94O90S8 Source Peptides Synthesis Storage Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence KIDGYPVDYW NCKRICWYNN KYCNDLCKGL KADSGYCWGW TLSCYCQGLP DNARIKRSGR CRA (Modifications: Disulfide bonds: 12-61, 16-37, 23-44, 27-46) APPLICATION OF KKURTOXIN Kurtoxin, a 63-amino acid peptide stabilized by four disulfide bonds, is the first reported peptide inhibitor of T-type voltage-gated calcium channels If you want to know more about peptide polypeptide, please contact us.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:12 GMT
KALIOTOXIN

The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels. SPECIFICATION OF KALIOTOXIN CAT K1070-V CAS NO. 145199-73-1 Product Name Kaliotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4149.89 Da Molecular formula C171H283N55O49S6 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) APPLICATION OF KALIOTOXIN Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system. As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about peptide library, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:09 GMT
SPECIFICATION OF IBERIOTOXIN

CAT K1060-V CAS NO. 129203-60-7 Product Name Iberiotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4230.9 Da Molecular formula C179H276N50O56S7 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) APPLICATION OF IBERIOTOXIN Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel. As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about synthetic route, please visit our website.

Contact:
Phone:
Fax:
Email:
KSVPeptide
0551-65120828

Send Inquiry
Hefei KS-V Peptide Biological Technology Co., Ltd.
The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
Anhui 230031
China
3/3/22 3:08 GMT
Serum Plasma CDV Ab Dog Test Kits , Canine Distemper Test Kit

PRODUCT FEATURES Fast results Easy visually interpretation Simple operation, no equipment required Principle: Chromatographic Immunoassay Specimen: Serum/Plasma Pack: 10 T Shelf Life: 2 Years Specificity: 98.00% Format: Cassette Reading Time: 10 Minutes Storage Temperature: 4-30℃ Sensitivity: 98.00% Accuracy: 98.00% Application: The CDV Antibody Rapid Test Cassette is a lateral flow immunochromatographic assay for qualitative detection of Canine Distemper Virus Antibody in canine’s serum or plasma.

Contact:
Phone:
Fax:
Email:
Mrs. Selina
86-571-56267891
86-571-56267891
Send Inquiry
Hangzhou AllTest Biotech CO.,LTD
550# Yinhai Street, Hangzhou Economy and Development Area
Hangzhou 310000
China
3/3/22 3:05 GMT
MONDE excavator clamshell bucket

Features Clamshell bucket is the bucket that can open and close to grasp the sediment and all kinds of bulk cargo.It is a kind of spreader that mainly rely on the left and right two combined bucket or multiple jaw opening crawl and unloading materials.The grab overall structure is light and durable,offering high grabbing ratio,strong closing force and high material filling rate. Packing 1. We pack the products by simple pallet or case which is seaworthy. 2. Fast delivery time: 5-7 days for small quantity, and 20-30 days for container quantity. 3. We have a team specialized in packing and loading container, they have rich experience, and can load the max quantity products, which can help customer save the ocean freight. Company Shandong Mingde Machinery co., Ltd produce many kinds of excavator attachments such as: buckets, ripper, boom & arm, grapple, quick coupler, hydraulic shear, hydraulic clamp, hydraulic vibration hammer, hydraulic crusher, milling machine, screener, strength boom & arm, tamping bucket, bulldozer shovel, bulldozer push beam, bulldozer ripper, loader bucket, loader timer grapple, show shovel etc. We have many kinds of top quality attachments products to fit all type of excavators, bulldozers and loaders. Also, we have our own import/export company, our products are exported to all over the world, based on our quality and the best after-service. In the year 2011, Shandong Mingde Machinery Co,Ltd has set up joint venture with a HongKong Investment Co. Ltd namely Shandong Mingde Gangcheng Machinery Co.,Ltd with WMS brand. Now our company has two brand names and so we will try our best to develop the international market in future. In 2012, we have further cooperation with Japan Ueda Industries Co, Ltd to produce "Bucket Crusher", "Calm Screener", "Vibro Bucket" and many other types of attachments, so that we can provide much more cost-effective products and the best after sales service for our customers.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
Jason
15092661183

Send Inquiry
Shandong Mingde Machinery Co.,ltd
No. 15, Kaiyuan Road, High-Tech Zone
Jining 272000
China
3/3/22 3:04 GMT
MONDE excavator rotary screening bucket

The MSB bucket comes equipped with an interchangeable mesh system around the drum inner circumference and replaceable sections in the conical rear area of the drum. Four models are offered to fit mini diggers from 6 tonne to 36 tonne excavator. Suitable for top-soil, quarried stone, remediation of contaminated soils beaches, demolition waste and green recycling duties. The MSB series is just at home clearing on a demolition site or in the quarry cleaning and sizing stone. Feartures Preliminary screening of waste materials, demolition, excavation and re- filling, and soil rebuilding of rocky land. The screening bucket is suitable for sorting natural materials before and after comminution, reducing the comminution time by 60%, so that materials that are compatible with the type of processing required can be recycled and managed. With the inching hydraulic system, even wet materials can be screened, increasing production by 30% year- on-year. It is suitable for gravel screening and beach cleaning in waterways. It is a good assistant for screening fine debris blocks. The size of the sorting screen can be adjusted by changing the screen. Screen sizes from 10mm to 150mm are available. Can be made according to customer needs. 1. The mesh hole is not easy to block. 2. The operation is stable and the noise is low. 3. Simple structure and convenient maintenance. 4. The screening cylinder can be rotated forward and backward for easy screening. 5. The reliability of the whole machine is high, and the one-time investment is less. 6, the use of special mesh, high screening efficiency, long service life. Packing 1. We pack the products by simple pallet or case which is seaworthy. 2. Fast delivery time: 5-7 days for small quantity, and 20-30 days for container quantity. 3. We have a team specialized in packing and loading container, they have rich experience, and can load the max quantity products, which can help customer save the ocean freight. Company Shandong Mingde Machinery co., Ltd produce many kinds of excavator attachments such as: buckets, ripper, boom & arm, grapple, quick coupler, hydraulic shear, hydraulic clamp, hydraulic vibration hammer, hydraulic crusher, milling machine, screener, strength boom & arm, tamping bucket, bulldozer shovel, bulldozer push beam, bulldozer ripper, loader bucket, loader timer grapple, show shovel etc. We have many kinds of top quality attachments products to fit all type of excavators, bulldozers and loaders. Also, we have our own import/export company, our products are exported to all over the world, based on our quality and the best after-service. In the year 2011, Shandong Mingde Machinery Co,Ltd has set up joint venture with a HongKong Investment Co. Ltd namely Shandong Mingde Gangcheng Machinery Co.,Ltd with WMS brand. Now our company has two brand names and so we will try our best to develop the international market in future. In 2012, we have further cooperation with Japan Ueda Industries Co, Ltd to produce "Bucket Crusher", "Calm Screener", "Vibro Bucket" and many other types of attachments, so that we can provide much more cost-effective products and the best after sales service for our customers.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
Jason
15092661183

Send Inquiry
Shandong Mingde Machinery Co.,ltd
No. 15, Kaiyuan Road, High-Tech Zone
Jining 272000
China
3/3/22 2:57 GMT
3 Phase Aluminum MIG Welding Machine CNC MIG 350 350A Amperage

MIG-250 PULSE is a new generation innovative item, which is designed for easy welding. Inbuild Synergy mode and MIG setting mode, no matter what your welding skill, you can weld perfect effects. 4 rolls driven separated wire feeder, 15kg coil IGBT technology Multi-process including MIG/LIFT TIG/MMA functions It can weld many different kinds of material, mild steel, stainless steel, aluminum, copper and ect. Pulse welding, spot welding TECHNICAL PARAMETERS UNIT MIG-250 PULSE Rated input voltage V AC380V±15% 50/60 Rated input power KVA 9.5 Output current range A MIG:40-350 MMA:30-300 TIG:10-300 Duty cycle % 250A 60% / 194A 100% Wire feeder Integrated Wire feeding speed m/min 2-18 Welding plate thickness Mm 0.5-6 Feeding wire diameter 0.8-1.2 Machine dimensions Mm 820 x 510 x 800 Net weight Kg 44

Contact:
Phone:
Fax:
Email:
Mr. Rocky
86-757-85726673
86-757-85726671
Send Inquiry
Foshan Sanqiao Welding Industry Co., Ltd.
No.60, DongYu industrial park LianAn avenue, Foshan, Guangdong.
Foshan 528000
China
3/3/22 2:52 GMT
Vacuum Spraying Production Line

Metal/Glass/Wood UV Vacuum Coater for Sale We are a professional manufacturer of plane, curved surface, printing and coating, sanding and polishing equipment. We are committed to providing our customers with high-quality vacuum coater for sale on metal/glass/wood. Vacuum coater for wood machine mainly refers to a type of coating that needs to be carried out under a higher vacuum. Marble UV coating line line can widely in building material, outside the room and inside room and bathroom, which machine coating material is fiber cement and calcium silicate board. Specification of UV Spray Coating Machine Place of Origin Jiangsu, China ChinBrand Name KISINHOM Condition New Machine Type other uv wood coating machine Warranty 1 Year Certification CE ISO9001 Application Plywood, solid wood, particleboard After Warranty Service Video technical support, Online support, Spare parts, Field maintenance and repair service Metallizing Vacuum Coating Process The vacuum coater for sale uses the high-speed motion of positive ions generated by gas discharge under the action of electric field to bombard the target as the cathode, so that atoms or molecules in the target material escape and precipitate on the surface of the workpiece to be plated, forming the required film. The most commonly used vacuum evaporation coating is the resistance heating method, which has the advantages of simple structure of the heating source, low cost and convenient operation. Vacuum Paint Coating Machine Applications The vacuum spraying production line of vacuum coating machine is fully automated and specially designed for the surface water-based primer and UV light curing materials such as furniture, floor, door cover line, footing line, picture frame, wall panel, marble line, blinds and so on. The operation of the vacuum spraying production line is very simple, the paint can be changed conveniently during the on-line operation, and it is easy to clean. As one of the PVC coating machine manufacturers china, Suzhou Kisinhom Machinery Co., Ltd. was established on April 10, 2018 and is located at No. 168, Nanyuan Road, Dianshanhu Town, Kunshan City, Jiangsu Province.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
KISINHOM
0512-5513 2371

Send Inquiry
Suzhou Kisinhom Machinery Co., Ltd.
NO.168-1 Nanyuan road,Dianshanhu town,Kunshan city,Jiangsu province
suzhou 235345
China
3/3/22 2:51 GMT
UV LED Drying Machine

UV Drying Machine FUNCTION: This machine is available to drying the UV paint after painting to dry quickly. PRODUCT DESCRIPTION: The service life of this machine is more than 10 times that of a traditional mercury lamp curing machine, and the maintenance cost is almost zero. Without mercury, UV-led light wave is simple (365NM-405NM optional), no other clutter is generated, no low band ultraviolet light harmful to the human body is produced, and the harm to the human body is small. Module control, according to the actual production control light length and area, length from 20mm to 1000 mm, electric power can also be adjusted to 10%to 100%, greatly reducing waste. Specification of UV LED Drying Machine Model KISINHOM-1300# Working width 600 mm/1300 mm Working thickness 3-80 mm Minimum length 300 mm Feeding speed 0-20 m/min Feeding power 0.75 kW Application Plywood, solid wood, particleboard, HPL, PVC, WPC, SPC, metal, glass, plastic, ceramic tile, calcium silicate board, cement fiberboard, gypsum board, melamine board, stainless steel, vermiculite board As one of the PVC coating machine manufacturers china, Suzhou Kisinhom Machinery Co., Ltd. was established on April 10, 2018 and is located at No. 168, Nanyuan Road, Dianshanhu Town, Kunshan City, Jiangsu Province.

Contact:
Phone:
Fax:
Email:
KISINHOM
0512-5513 2371

Send Inquiry
Suzhou Kisinhom Machinery Co., Ltd.
NO.168-1 Nanyuan road,Dianshanhu town,Kunshan city,Jiangsu province
suzhou 235345
China
3/3/22 2:50 GMT
High Gloss Lamination Machine

High Gloss Lamination Machine High-quality floors require low-temperature and long-term pressure retention, so ordinary single-laminators cannot meet the demand. The multi-layer high- gloss UV lamination machine is tailor-made to produce high-quality gloss floors and ensure the output of the press. Specification of High Gloss UV Laminator Model Working width Working thickness Minimum length Feeding power L/W/H/MM 1300# 1300MM 3-80MM 300MM 15KW 4000MM/2000MM/2300MM As one of the PVC coating machine manufacturers china, Suzhou Kisinhom Machinery Co., Ltd. was established on April 10, 2018 and is located at No. 168, Nanyuan Road, Dianshanhu Town, Kunshan City, Jiangsu Province.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
KISINHOM
0512-5513 2371

Send Inquiry
Suzhou Kisinhom Machinery Co., Ltd.
NO.168-1 Nanyuan road,Dianshanhu town,Kunshan city,Jiangsu province
suzhou 235345
China
3/3/22 2:49 GMT
Furniture UV Coating Production Line

Furniture UV Coating Production Line The UV wood coating machine coats the rolled substrate with a layer of glue, paint or ink with a specific function, and then winds it after drying. UV coating line for sale uses a dedicated high-speed coating head, which can effectively reduce the generation of bubbles. The rewinding and unwinding of the industrial coating machine are equipped with a full-speed automatic film splicing mechanism, and the tension is automatically controlled by a closed loop. Specification of UV Coating Machine Place of Origin Jiangsu, China ChinBrand Name KISINHOM Condition New Machine Type other woodworking machines Warranty 1 Year Certification CE ISO9001 Application Plywood, solid wood, particleboard After Warranty Service Video technical support, Online support, Spare parts, Field maintenance, and repair service The Advantage of the Furniture UV Coater Machine The industrial coating machine is equipped with micro-gravure coating technology, precision scraper, automatic gap adjustment, five-roll coating, zero-speed rewinding and unwinding, and other necessary technologies for the production of high-quality products. UV coating machine for sale also adopts original imported accessories and learn the technical advantages of similar machinery around the world. Continuously innovate coating technologies such as coating, drying, unwinding, and coiling, and independent research and develop new units to improve manufacturing quality. UV Coater Machine Applied in Wood Furniture As a professional coating machine manufacturer, our UV coating machine for sale is widely used in wooden furniture. Our machine is a full-precision two-roll coater, which is precisely operated. The products manufactured by our high- quality coating machine have high-quality materials, fine workmanship and reliable quality. In addition, the high efficiency of the UV coater for sale greatly improves the production efficiency; the stable structure ensures the safe and stable production process; the long life of the industrial coating machine saves customers' use costs; we provide the best after-sales service and will sincerely solve the problem for you. As one of the PVC coating machine manufacturers china, Suzhou Kisinhom Machinery Co., Ltd. was established on April 10, 2018 and is located at No. 168, Nanyuan Road, Dianshanhu Town, Kunshan City, Jiangsu Province.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
KISINHOM
0512-5513 2371

Send Inquiry
Suzhou Kisinhom Machinery Co., Ltd.
NO.168-1 Nanyuan road,Dianshanhu town,Kunshan city,Jiangsu province
suzhou 235345
China
3/3/22 2:48 GMT
Furniture Panels Varnish UV Roller Coater Putty Filling Machine

Furniture Panels Varnish UV Roller Coater Putty Filling Machine This wood varnish machine is suitable for surface coating with thicker plates(such as panel furniture, bamboo flooring, MDF board, particleboard, calcium silicate board, etc) Specifications of Furniture Panels Varnish UV Roller Coater Putty Filling Machine Model 1300# Item number kisinhom-1300# Working width 1300mm Working thickness 2-80mm Minimum length 300mm Feeding power 1.5kw Dimensions(L × W × H) 2100 × 2600 × 1500 As one of the coating machine suppliers, Suzhou Kisinhom Machinery Co., Ltd. was established on April 10, 2018 and is located at No. 168, Nanyuan Road, Dianshanhu Town, Kunshan City, Jiangsu Province.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
KISINHOM
0512-5513 2371

Send Inquiry
Suzhou Kisinhom Machinery Co., Ltd.
NO.168-1 Nanyuan road,Dianshanhu town,Kunshan city,Jiangsu province
suzhou 235345
China
3/3/22 2:47 GMT
Furniture Panels /Plywood Brushing Machine

Furniture Panels /Plywood Brushing Machine for Sale This brushing machines for wood is specially designed for the coloring of solid wood laminate flooring, furniture, and other flat plates, so that the pores of the wood surface are evenly colored, which supplements the uneven coloration of the coating machine. the wood grain of the surface plate treated by the wood brushing machine is more clear, more distinct. This wood brush machine is available to the base\surface paint coating for the furniture\flooring\cabinet\walling\decorative boards, which different materials as wood\MDF\plastic\metal\glass\Casi, and so on. Specification of Furniture Panels /Plywood Brushing Machine model Working width Feeding speed Feeding power Coater roller power Dimensions(L×W×H) 600# 600mm 0-20m/min 0.75kw 0.75kw 1400×1550×1350mm 1000# 1000mm 0-20m/min 1.5kw 1.5kw 1400×1900×1350mm 1300# 1300mm 0-20m/min 1.5kw 1.5kw 1400×2200×1350mm As one of the coating machine suppliers, Suzhou Kisinhom Machinery Co., Ltd. was established on April 10, 2018 and is located at No. 168, Nanyuan Road, Dianshanhu Town, Kunshan City, Jiangsu Province.

Minimum Order: 1 bags

Contact:
Phone:
Fax:
Email:
KISINHOM
0512-5513 2371

Send Inquiry
Suzhou Kisinhom Machinery Co., Ltd.
NO.168-1 Nanyuan road,Dianshanhu town,Kunshan city,Jiangsu province
suzhou 235345
China


SOURCE: Import-Export Bulletin Board (https://www.imexbb.com/)
Result Page:   << Previous   |   3242  |   3243  |   3244  |   3245  |   3246  |   3247  |   3248  |   3249  |   3250  |   3251  |   3252  |   Next >>

Post an Offer to Sell
Home - Offers to Buy - Business Opportunities - Company Profiles

© 1996-2026 IMEXBB.com. All rights reserved.

IMEXBB.com