Offers to Sell

Advantages Of 8 Layer ENIG Half Hole custom made circuit boards Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 8 Layer ENIG Half Hole Custom PCB Now the custom pcb price is not high, if you want to buy custom pcb, please contact us. As a professional circuit board company, Huihe Circuits is characterized by ‘High Quality, Accurate Delivery and Reasonable Price’, and adhere to the core values of ‘Stick with customer oriented, pursue excellent quality.’ Huihe Circuits is consistent in providing high-quality, quick response, satisfactory services for clients all over the world. Looking forward to the future, our stage is vast. We are sincere, persistent and aggressive at work. We meet difficult challenge and seize every opportunity to make progress. We hope to cooperate with you to realize our mutual development and long term benefit.

Minimum Order: 1 bags

Thick copper pcb and heavy copper pcb, pcb fabrication up to 12oz, large current, pcb fabrication base material is FR4/Teflon/Ceramic, pcb fabrication used in high-power power supply and motor circuits products. HUIHE CIRCUITS Heavy Copper PCB has passed ISO9001 / ISO13485 /IATF16949 / UL /RoHS / REACH certification. Heavy Copper PCB List 2 Layer ENIG Heavy Copper PCB Manufacturers 4 Layer ENIG Heavy Copper PCB 6 Layer ENIG Heavy Copper PCB supplier 6 Layer ENIG Heavy Copper PCB manufacturing 6 Layer ENIG Heavy Copper PCB Fabrication Service 6 Layer ENIG Heavy Copper PCB 8 Layer ENIG Heavy Copper PCB 8 Layer ENIG Impedance Control Heavy Copper PCB 2 Layer ENIG Heavy Copper PCB The Copper Plating Process Must Achieve The Following Aspects: 1. Add a certain value according to the area value calculated by the computer and the empirical constant accumulated in the actual production to ensure the integrity of the plating layer in the hole. 2. When the circuit board is electroplated for 5 minutes, take out the substrate and observe whether the copper layer on the surface and the inner wall of the hole is intact. It is better that all the holes have a metallic luster. 3. A certain distance must be maintained between the substrate and the substrate. 4. When the thick copper plating reaches the required electroplating time, a certain amount of current must be maintained during the removal of the substrate to ensure that the surface of the substrate and the hole will not be blackened or darkened. 5. According to the mechanical processing floppy disk for trial processing, the first part pre-inspection is carried out, and all the workpieces are processed after meeting the technological requirements. Thick Copper Plate Quality Control 1. Strictly implement the first article inspection system to ensure that the product size meets the design requirements. 2. According to the raw materials of the circuit board, reasonably select the milling process parameters. 3. When fixing the position of the circuit board, carefully clamp it so as not to damage the solder layer and solder mask on the surface of the circuit board. 4. To ensure the consistency of the substrate dimensions, the position accuracy must be strictly controlled. 5. When disassembling and assembling, pay special attention to the barrier layer of the substrate and pad paper to avoid damage to the coating layer on the surface of the pcb circuit board. As a Chinese pcb manufacturer, we have different types of products for sale, if you have needs, please contact us.

Minimum Order: 1 bags

Advantages Of 4 Layer ENIG Impedance Control Half Hole PCB Electric Circuit Board Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 4 Layer ENIG Impedance Control Half Hole PCB Electric Circuit Board As a 4 layer pcb manufacturer, we provide 4 layer pcb for sale, if you have needs, please contact us. Huihe Circuits is a professional printed circuit board supplier of high- density multilayer printed circuit boards, prototype and mass production PCB’s. There is a wholly-owned factory in Jiangxi, China. The plant area is 12,000 square meters. Huihe Circuits has been certified for ISO9001, IATF16949, ISO13485, OHSAS18001 and PCB products have been certified for UL, RoHS, REACH. If you want to know more about pcb manufacturing process, please visit our website.

Minimum Order: 1 bags

Advantages of cheap 4 layer pcb Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 4 Layer ENIG Impedance Control Half Hole Fr4 PCB Now the 4 layer pcb cost is not high, if you have needs, please contact us. As a pcb board supplier, we have various types of pcb product for sale, and the 2 layer pcb price is affordable, if you have needs, please contact us. If you want to buy printed circuit board, please leave us a message.

Minimum Order: 1 bags

ASIC1 channels, Mambalgin 1 is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. 1609937-15-6 Product Name Mambalgin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 6554.5 Da Molecular formula C272H429N85O84S10 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETEN , NKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) APPLICATION OF MAMBALGIN 1 Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells. As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us. More information about our pre clinical trial, please visit our website.

Advantages Of 2 Layer OSP Impedance Control Half Hole PCB Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Quick turn, prototype, medium or large batches can be produced to meet the needs of different customers. Quick response to quotes. Packing And Delivery Of 2 Layer OSP Impedance Control Half Hole PCB If you want to know more about osp pcb finish , please contact us. As a circuit board supplier, we have various types of pcb product for sale, and the 2 layer pcb price is affordable, if you have needs, please contact us.

Minimum Order: 1 bags

Advantages of 2 layer pcb board Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 2 Layer ENIG Impedance Control Half Hole PCB As a 2 layer pcb manufacturer, we have pcb boards for sale, and the 2 layer pcb price is affordable, if you have needs, please contact us. As a printed circuit board maker, HUIHE CIRCUITS has focused on Printed Circuit Board manufacturing for more than 10 years with a professional engineering team and experienced production team.

Minimum Order: 1 bags

L Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs in high concentrations in muscle and brain tissue. SPECIFICATION OF L CARNOSINE Purity(HPLC) ≥98% Content ≥99% 20% below market price 1000+kg per month Fast delivery APPLICATION OF L CARNOSINE Product Name L-Carnosine β-Alanyl-L-histidine H-β-Ala-His-OH CAS-No. 305-84-0 Molecular Formula C9H14N4O3 Sequence β-Ala-His Molecular Weight 226.232g/mol Package 1kg, 25kg, customizable Appearance White powder Application Cosmetic raw materials Storage 2～8℃ Efficacy and Mechanism of Action: Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water- borne antioxidant with wound healing activity and naturally occurs in high concentrations in muscle and brain tissue. Carnosine is an unsaturated aldehyde that scavenges reactive oxygen species and peroxidizes fatty acids in cell membranes during oxidative stress. Low molecular weight water-soluble unmodified dipeptide-Ala-His has very little affinity for skin and does not penetrate beyond the first layer of cuticle. However, the lipophilic peptide palmitoyl-Ala-His diffused into the cuticle, epidermis, and dermis, and no systemic activity was observed. If you want to know more about l carnosine price, please contact us. As a peptide supplier, we will produce more high quality products for customers, if you have needs, please contact us. More information about our chemical structure identification, please visit our website.

Advantages Of two sided pcb Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 2 Layer ENIG Half Hole PCB As a pcb circuit manufacturer, we will offer high quality products for sale, if you have needs, please contact us.

Minimum Order: 1 bags

Half Hole & through hole circuit board, no copper burr residue or warpage in half hole, reduce connectors and save space, apply to Bluetooth module and Signal receiver products. HUIHE CIRCUITS Half Hole & Through Hole PCB, apply to Bluetooth module and Signal receiver products. Has passed ISO9001 / ISO13485 /IATF16949 / UL /RoHS / REACH certification. Half Hole & Through Hole PCB List 2 Layer OSP Impedance Control Half Hole PCB 2 Layer ENIG Half Hole PCB 4 Layer ENIG Impedance Control Half Hole PCB Electric Circuit Board 2 layer ENIG impedance control half hole pcb 8 layer ENIG half hole custom PCB 4 layer ENIG impedance control half hole fr4 PCB 4 layer ENIG impedance control half hole PCB 4 layer LF-HASL half hole PCB Production Process Of Metallized Half-Hole PCB For the front inversion, to prevent the quality of the product and the need to make corrections in the later process, the production process of this type of board is processed according to the following process: a drilling (drilling, gong groove-plate surface plating-external Optical imaging-pattern plating-co- drying-half-hole processing-film stripping, etching, tin stripping-other processes-shape Main Points Of Metallized Half-Hole PCB Production The specific metallized half-holes are processed in the following way: all metallized half-hole PCB holes must be drilled in the pattern after plating, and one hole at the intersection of the two ends of the half-hole should be drilled before etching. The engineering department formulates the MI process according to the process The metal half-hole is the second-drilled half-hole drilled during the first drilling (or gong), after the image is plated, and before the etching. It is necessary to consider whether the copper will be exposed when the gong groove is shaped, and move the drilled half-hole into the unit. he right hole is drilled first, and then the board is turned over (or mirrored) and the left hole is drilled to reduce the pulling of the copper of the inner hole of the half hole by the drill, resulting in the lack of copper of the hole. The size of the drill nozzle for drilling the half hole depends on the spacing of the contour lines. Draw the solder mask film, use the gong space as a stop point and open the window to increase 4mil treatment. The Designer's Suggestion When Designing The Circuit Change the distance from the edge line to the hole center. The general design is to place the hole center on the edge line and move the control center down. For example, the diameter of the hole is 1.4mm, the distance between the two holes is 2.54mm, and the board edge The distance between the line is 0.33mm from the center of the through hole, and the thickness of the plate is 0.6mm. The angle between the tangent to the cut point of the wall and the track of the milling cutter was 90 degrees before, but this time it is about 60 degrees. Because the board edge line is at a certain distance from the center of the through hole, the cutting angle of the milling cutter is changed, and the board thickness is extremely small, so the copper in the hole is not easily pulled out. The simultaneous improvement of small batch pcb design and production can greatly improve the production yield of pcb board with holes. In our circuit board factory, we have types of pcb board for sale, if you have needs, please contact us.

Minimum Order: 1 bags

SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. 820959-57-7 Product Name kurtoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 7386.36 Molecular formula C324H478N94O90S8 Source Peptides Synthesis Storage Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence KIDGYPVDYW NCKRICWYNN KYCNDLCKGL KADSGYCWGW TLSCYCQGLP DNARIKRSGR CRA (Modifications: Disulfide bonds: 12-61, 16-37, 23-44, 27-46) APPLICATION OF KKURTOXIN Kurtoxin, a 63-amino acid peptide stabilized by four disulfide bonds, is the first reported peptide inhibitor of T-type voltage-gated calcium channels If you want to know more about peptide polypeptide, please contact us.

The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels. SPECIFICATION OF KALIOTOXIN CAT K1070-V CAS NO. 145199-73-1 Product Name Kaliotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4149.89 Da Molecular formula C171H283N55O49S6 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) APPLICATION OF KALIOTOXIN Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system. As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about peptide library, please visit our website.

CAT K1060-V CAS NO. 129203-60-7 Product Name Iberiotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4230.9 Da Molecular formula C179H276N50O56S7 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) APPLICATION OF IBERIOTOXIN Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel. As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us. If you want to know more about synthetic route, please visit our website.

PRODUCT FEATURES Fast results Easy visually interpretation Simple operation, no equipment required Principle: Chromatographic Immunoassay Specimen: Serum/Plasma Pack: 10 T Shelf Life: 2 Years Specificity: 98.00% Format: Cassette Reading Time: 10 Minutes Storage Temperature: 4-30℃ Sensitivity: 98.00% Accuracy: 98.00% Application: The CDV Antibody Rapid Test Cassette is a lateral flow immunochromatographic assay for qualitative detection of Canine Distemper Virus Antibody in canine’s serum or plasma.