Offers to Sell

PVC Profile Extrusion Line This PVC profile extrusion line features stable plasticization, high output, low sheering force, long life service, and other advantages during PVC profile extrusion process. The production line consists of control system, conical twin-screw extruder or parallel twin screw compounding extruder, extrusion die, calibration unit, haul-off unit, film coverina machine, and stacker The extruder is equipped with AC variable frequency or DC speed drive, imported temperature controller. The calibration unit's pump and haul-off unit's reducer are famous brand products. After simple changing of the die and screw and barrel, it also can produce the foam profiles, the effect can be better than single screw extruder. PVC Profile Extrusion Line Application PVC extrusion manufacturers' PVC profile extrusion line mainly uses PVC, UPVC as raw materials, produces a variety of plastic doors and windows, protect rails, hollow boards, decorative profiles, etc., is applied to home, building materials, outdoor landscapes, white appliances, livestock farming, car transportation and other life, industrial each field! PVC Profile Extrusion Line Performance and Advantages The PVC profile extrusion line can adopt parallel, or tapered twin-screw extruders, host and traction devices, with high-performance variable frequency regulators, and high-precision speed adjustment, depending on the actual production needs of the user. Temperature control uses a temperature control instrument such as Japan RKC and Omron, Accurate temperature control; vacuum molded table adopts water cycle-type sealed energy-saving vacuum system, configuring centralized water supply and quick-replacement connector, can replace different forms of molding molds easily and conveniently quickly and conveniently. The molding station can choose to use 4 meters, 6 meters, 8 meters, 13 meters, 18 meters, and other dimensions; tractor adopts crawler tractor, can ensure stable and non-deformation of the profile extrusion process; automatic film apparatus ensures extruded profile the surface appearance, shiny; The cutting device is a synchronous tracking structure, which ensures that the product is flat, and there is no collapse. The unit has the characteristics of low energy consumption, stable performance, high speed, and efficacy. The shape of profile shape extruded with this unit is beautiful, strong compressive performance, good light stability, and thermal stability, low dimensional rate, anti-aging. JWELL Extruder China a high–tech manufacturer specializing in research and development of yarn spinning machine, plastic extrusion lines. High qualified R&D and experienced mechanical and electrical engineer team, as well as advanced processing foundation and normative assembly shop.

Minimum Order: 1 bags

Automatic Blow Molding Machine 1. In recent years, the electric blow molding machine has great advantages in the clean production and energy saving of blow molded products, and automatic blow molding machine's research and development progress are relatively fast. For some blow molding production workshops that require a high degree of cleanliness, electric blow molding units will be one of the first choices. 2. Raw material plasticization, extrusion, mold shifting, mold closing, and blow molding are all driven by high-performance servo motors, completely replacing traditional hydraulic drive technology, energy-saving and environmentally friendly, and fully automatic blow molding equipment and auto deflashing blow moulding machine are excellent equipment for modern industrial production. 3. At present, the general electric hollow molding machine is mainly used in some high-end blow molding product industries and industries that require highly clean production. With the further reduction of automatic blowing machine and fully automatic blow moulding machine equipment manufacturing price and costs, it may be promoted to other blow molding product industries. 4. At present, large and medium-sized (high tonnage clamping force) electric hollow forming units are relatively rare. With the increasing requirements for the clean production of some large and medium-sized plastic barrels, the development of large and medium-sized electric hollow molding machines will likely be accelerated. To seize the development time is to seize the market. Automatic Blow Molding Machine Application JWELL machine china is researching and developing a fully electric Blow molding machine to meet the Food, Medical, Health, and other industries' requirment for the machine and product clean. Compare with the traditional Hydraulic type blow molding machine, The fully electric blow molding machine adopts fully servo- driving motor, energy-saving about 30%.No oil-leakage. Fully automatic blow moulding machine has low noise and can keep the workshop. Automatic Blow Molding Machine Performance and Advantages Energy consumption The use of servo motors and servo drives can effectively save energy, and the energy-saving efficiency is generally 50% to 70% (depending on the product). Cleanliness and noise All servo motors are used, and there is no noise caused by hydraulic pumps. The decibels are reduced by 10-15dB. There is no oil leakage problem. The workshop is very clean and easy to maintain. Response Faster response time, greater efficiency, and control range. Higher and wider, especially suitable for high-speed and large-volume extrusion blow molding machine. Accuracy and repeatable positioning fully closed-loop control, high-precision encoder, controllable within 0.02mm, suitable for the production of high-precision products, high repeat positioning accuracy. JWELL Extrusion Machinery Co., Ltd, a high–tech manufacturer specializing in research and development of extrusion machine, plastic extrusion lines. High qualified R&D and experienced mechanical and electrical engineer team, as well as advanced processing foundation and normative assembly shop.

Minimum Order: 1 bags

We produce and assemble metal steel structures of various shapes and sizes according to the needs of our customers. We are on hand to provide you with advice and ideas to help you design and visualize the steel structure of your choice. Grid steel structure workshop is a network structure composed of many pole frames. It is a high-order statically indeterminate space structure. The grid structure can be divided into two types: plane grid and curved grid. Plane grids are used more, and their advantages are: space force system, rods mainly bear axial force, reasonable force, good overall performance of material saving, high rigidity, and good seismic performance. There are few types of rods, which are suitable for industrial production. Delivery time: 15-30days Price term： EXW, FOB, CIF, CFR, CNF, etc. Payment： L/C, T/T, Western Union, etc. Port Delivery： Qingdao, Shanghai, Tianjin, Shenzhen, etc. Learn more: https://www.faststeelfactories.com/

Minimum Order: 1 bags

Features: Standard Polymer battery pack 1s1p with 3.8V / 510mAh /1.838 Wh Worldwide approvals and certification of safety standards No development costs, fast time-to-market lithium-ion cells with the market’s highest energy density Product materials can be customized according to customer requirements Numerous and redundant safety features, e.g. CUV (Cell Under Voltage): protection against deep discharge COV (Cell Over Voltage): protection against over charge OTD (Over Temperature in Discharge): Protection against overheating during discharging Life expectancy: Up to 80% of initial capacity after 500 cycles High Light: Rechargeable batteries have built-in high quality PCB board, thermal protectors and circuit breakers, effectively avoiding the over-charge, and short circuit. High Capacity with Small Size Product Description: This is our newly designed polymer battery pack. With the latest structural design, the battery capacity of 510mah is made in a very small size, which is suitable for the internal layout of various small-size electronic products. The battery can also be used in medical products and wearable products, and is suitable for various Bluetooth headset trackers, etc.

As a professional peptide company in China, we provide a variety of modified histones catalog products. Customized synthesis of modified histones, from ug to g with 70% to 99% purity, can also be made according to your requirements. Modified histones can be applied to nucleosome assembly and the subsequent study of biochemical function and structure. Histones are proteins that condense and package DNA neatly into chromosomes. Different types of histone modifications affect different processes in the cell such as the activation/ inactivation of transcription, chromosome packaging, DNA damage and DNA repair. The histone modifications is an important post- translational process that plays a key role in gene expression. Histone modifications impact gene expression by changing the structure of chromatin or through the recruitment of histone modifiers. Histones pack DNA into structures called nucleosomes, to fit the DNA molecule into the nucleus. Each of these nucleosomes has two subunits, each comprising the core histone H2A protein, histone H2B protein, histone H3 protein and histone H4 peptide, and a linker histone called H1 that acts as a stabilizer. If you want to know the process of peptide manufacturing, please contact us.

Advantages Of 8 Layer ENIG Half Hole custom made circuit boards Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 8 Layer ENIG Half Hole Custom PCB Now the custom pcb price is not high, if you want to buy custom pcb, please contact us. As a professional circuit board company, Huihe Circuits is characterized by ‘High Quality, Accurate Delivery and Reasonable Price’, and adhere to the core values of ‘Stick with customer oriented, pursue excellent quality.’ Huihe Circuits is consistent in providing high-quality, quick response, satisfactory services for clients all over the world. Looking forward to the future, our stage is vast. We are sincere, persistent and aggressive at work. We meet difficult challenge and seize every opportunity to make progress. We hope to cooperate with you to realize our mutual development and long term benefit.

Minimum Order: 1 bags

Thick copper pcb and heavy copper pcb, pcb fabrication up to 12oz, large current, pcb fabrication base material is FR4/Teflon/Ceramic, pcb fabrication used in high-power power supply and motor circuits products. HUIHE CIRCUITS Heavy Copper PCB has passed ISO9001 / ISO13485 /IATF16949 / UL /RoHS / REACH certification. Heavy Copper PCB List 2 Layer ENIG Heavy Copper PCB Manufacturers 4 Layer ENIG Heavy Copper PCB 6 Layer ENIG Heavy Copper PCB supplier 6 Layer ENIG Heavy Copper PCB manufacturing 6 Layer ENIG Heavy Copper PCB Fabrication Service 6 Layer ENIG Heavy Copper PCB 8 Layer ENIG Heavy Copper PCB 8 Layer ENIG Impedance Control Heavy Copper PCB 2 Layer ENIG Heavy Copper PCB The Copper Plating Process Must Achieve The Following Aspects: 1. Add a certain value according to the area value calculated by the computer and the empirical constant accumulated in the actual production to ensure the integrity of the plating layer in the hole. 2. When the circuit board is electroplated for 5 minutes, take out the substrate and observe whether the copper layer on the surface and the inner wall of the hole is intact. It is better that all the holes have a metallic luster. 3. A certain distance must be maintained between the substrate and the substrate. 4. When the thick copper plating reaches the required electroplating time, a certain amount of current must be maintained during the removal of the substrate to ensure that the surface of the substrate and the hole will not be blackened or darkened. 5. According to the mechanical processing floppy disk for trial processing, the first part pre-inspection is carried out, and all the workpieces are processed after meeting the technological requirements. Thick Copper Plate Quality Control 1. Strictly implement the first article inspection system to ensure that the product size meets the design requirements. 2. According to the raw materials of the circuit board, reasonably select the milling process parameters. 3. When fixing the position of the circuit board, carefully clamp it so as not to damage the solder layer and solder mask on the surface of the circuit board. 4. To ensure the consistency of the substrate dimensions, the position accuracy must be strictly controlled. 5. When disassembling and assembling, pay special attention to the barrier layer of the substrate and pad paper to avoid damage to the coating layer on the surface of the pcb circuit board. As a Chinese pcb manufacturer, we have different types of products for sale, if you have needs, please contact us.

Minimum Order: 1 bags

Advantages Of 4 Layer ENIG Impedance Control Half Hole PCB Electric Circuit Board Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 4 Layer ENIG Impedance Control Half Hole PCB Electric Circuit Board As a 4 layer pcb manufacturer, we provide 4 layer pcb for sale, if you have needs, please contact us. Huihe Circuits is a professional printed circuit board supplier of high- density multilayer printed circuit boards, prototype and mass production PCB’s. There is a wholly-owned factory in Jiangxi, China. The plant area is 12,000 square meters. Huihe Circuits has been certified for ISO9001, IATF16949, ISO13485, OHSAS18001 and PCB products have been certified for UL, RoHS, REACH. If you want to know more about pcb manufacturing process, please visit our website.

Minimum Order: 1 bags

Advantages of cheap 4 layer pcb Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 4 Layer ENIG Impedance Control Half Hole Fr4 PCB Now the 4 layer pcb cost is not high, if you have needs, please contact us. As a pcb board supplier, we have various types of pcb product for sale, and the 2 layer pcb price is affordable, if you have needs, please contact us. If you want to buy printed circuit board, please leave us a message.

Minimum Order: 1 bags

ASIC1 channels, Mambalgin 1 is a blocker of ASIC1 channels1,2 SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. 1609937-15-6 Product Name Mambalgin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 6554.5 Da Molecular formula C272H429N85O84S10 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETEN , NKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) APPLICATION OF MAMBALGIN 1 Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells. As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us. More information about our pre clinical trial, please visit our website.

Advantages Of 2 Layer OSP Impedance Control Half Hole PCB Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Quick turn, prototype, medium or large batches can be produced to meet the needs of different customers. Quick response to quotes. Packing And Delivery Of 2 Layer OSP Impedance Control Half Hole PCB If you want to know more about osp pcb finish , please contact us. As a circuit board supplier, we have various types of pcb product for sale, and the 2 layer pcb price is affordable, if you have needs, please contact us.

Minimum Order: 1 bags

Advantages of 2 layer pcb board Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 2 Layer ENIG Impedance Control Half Hole PCB As a 2 layer pcb manufacturer, we have pcb boards for sale, and the 2 layer pcb price is affordable, if you have needs, please contact us. As a printed circuit board maker, HUIHE CIRCUITS has focused on Printed Circuit Board manufacturing for more than 10 years with a professional engineering team and experienced production team.

Minimum Order: 1 bags

L Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs in high concentrations in muscle and brain tissue. SPECIFICATION OF L CARNOSINE Purity(HPLC) ≥98% Content ≥99% 20% below market price 1000+kg per month Fast delivery APPLICATION OF L CARNOSINE Product Name L-Carnosine β-Alanyl-L-histidine H-β-Ala-His-OH CAS-No. 305-84-0 Molecular Formula C9H14N4O3 Sequence β-Ala-His Molecular Weight 226.232g/mol Package 1kg, 25kg, customizable Appearance White powder Application Cosmetic raw materials Storage 2～8℃ Efficacy and Mechanism of Action: Carnosine is a dipeptide (sequence: beta-Ala-His) and a well-documented water- borne antioxidant with wound healing activity and naturally occurs in high concentrations in muscle and brain tissue. Carnosine is an unsaturated aldehyde that scavenges reactive oxygen species and peroxidizes fatty acids in cell membranes during oxidative stress. Low molecular weight water-soluble unmodified dipeptide-Ala-His has very little affinity for skin and does not penetrate beyond the first layer of cuticle. However, the lipophilic peptide palmitoyl-Ala-His diffused into the cuticle, epidermis, and dermis, and no systemic activity was observed. If you want to know more about l carnosine price, please contact us. As a peptide supplier, we will produce more high quality products for customers, if you have needs, please contact us. More information about our chemical structure identification, please visit our website.

Advantages Of two sided pcb Own lamination process to convenient production for Multilayer PCB and shorten the lead time. Jiangxi facility is environmental-friendly approved by the government . Famous raw materials brand, Kingboard, Shengyi, ITEQ, Taiyo, Guangxin. Highly automated production line with AIO Optical Scanning, Electroplating Automatic Line, High-speed flying probe test machines and inkjet printer. Engineers with more than 15 years of experience Customers located in more than 20 countries, the common choice of 500 high-end companies. Perfect quality inspection system Professional R&D team can make all kinds of special boards. Sales office in Shenzhen and own 12,000sqm factory in Jiangxi. Establish an e-commerce system to reduce transaction costs and increase market response speed. Packing And Delivery Of 2 Layer ENIG Half Hole PCB As a pcb circuit manufacturer, we will offer high quality products for sale, if you have needs, please contact us.

Minimum Order: 1 bags